KEGG   Scleropages formosus (Asian bonytongue): 114909274Help
Entry
114909274         CDS       T04919                                 

Definition
(RefSeq) muscle M-line assembly protein unc-89-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sfm01001]
    114909274
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sfm04131]
    114909274
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sfm04812]
    114909274
   04147 Exosome [BR:sfm04147]
    114909274
Enzymes [BR:sfm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114909274
Protein kinases [BR:sfm01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   114909274
Membrane trafficking [BR:sfm04131]
 Others
  Actin-binding proteins
   Others
    114909274
Cytoskeleton proteins [BR:sfm04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     114909274
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114909274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set Ig_C17orf99 Adeno_E3_CR1 Ig_6 Egh16-like
Motif
Other DBs
NCBI-GeneID: 114909274
NCBI-ProteinID: XP_029103086
Position
21
AA seq 2293 aa AA seqDB search
MIFHGGEMGNVKTRREPQDTFLGTEDCLEHGLDSSSCFFIHTPINLSCENIKPSFTKKLK
FQSVVEGCPAIFKCKIIAIPSPKILWFHNNRPIPKECRRKILSESTMDVHTSSLVIECVK
DKDSGSYRVMAINTEGSAESTASLLVALKEEQYANYLNYVRQSTKIPQSTDSLAGQRTER
KVRVDLRCVGSPFDKKYKGLKGLSRSKHTLMRTVYFRTSSTSRIPDKVSLETASERARSP
PSMFEKSDRFNDRFSDIYCDRYTGRDRFSDRYSDRWSDRFSDTESLHGEIKTKLNILQKA
VKRKKRLSVSTMSSSEFDVESVASESSYADCFERIRIKPISLPEVQHVVRPFDHGEHSFI
KTSADFQNRLERITGLDMRNVESETTHVRHTFEPQSRSRAIQMMKGKLLNEHVREMGDED
VEDSALRKVEEVSEERNTQTQNECLLSDDQVISLKDTHIKLENPQPQWFEAGNLSNMLER
CHLPISGSEDNTKEIIQQYEDYSVEQSQRTKQVNLFKEGLLGEVVKQEDNMKSTKPESDC
KAMLKDTIYEKNLEIDVSENEDKFLTLRIRKWQEDLQLEHEAVQLDPHWTKDNSSFLKSE
GPSLKKVTDRETSPEKYETSGRKSSKLKATRAAKQMPFEKGIYEQHLSRENLSGREIESA
QFVSEKEALAQRIIKWQQDVLIEQEEAVDVETDWVDTYSAEASERKNELREQGETLAQNQ
ECPVEKSAAFTSVQAETKCGLSSHDHKVDSFQTDREIKFSDDNEITLNENIYFASEKEAM
TQRMIKWRHDILIEQEEAAELDSDWTAVDQSQYPTKETENLTFGVKGSVNEATQIQEKSL
KLPYETLQVKDKDVVPTILTPLEDINKWKSEYLSSEDQFVAQQCGHQYQDVVALKNTSLF
ESDLTEGKCIVDDQGTAAKIFNKKVDEAYTNYPPVIMKQLISLEVKKGEMSEFVCHFKGD
PEPTVTWFKDKQPILQNPDYDICTKKTESKLIICYPTTDHQGTYSCAITNKCGMTKSSAT
LIIIESPEVKKHPEVAKEVQVTTVEEMDDEHFEGMIERELELYINPKSEVKSTLQVPQLV
LQRSHADSSLHSSPVEIRITAPTPILELSEDMKESFEPIEKVPDISDEDNVLQTTKHKFT
FSFELSAEAPRVVKELENLICSEGQTAMLECIVIGEPVPTIMWFHDDSALTTANTKYRFE
DNGKIYRLYVDNFSSLDVGTYKLVATNKLGQAESIANVLFENSKEITPAMNTSEVSSQCS
VYVRATEGIDTEKDATKIMDVVNQFECPSLESVQSPFALLENMAPLQKGNNTDEFQGEGK
MIHSKEATSNRGAAITGCGLQSSGAIVNISKIKQAFEPSGLPENATKCEFSEPFFSKKEM
PKIVINPVEKELIQSEMKASSENIAHQIEDTNNLERATDKYHFVSLSNIKEVSQSHDLVK
PEAAIPVFCKSMLEREDDDFKKCTGEKGTGKSVDGTFVKQVSSISSLEKSQDQSSEQCSE
ITDLTFNSELAVVKPKQSFTLTSSSLWTKEQDVETASLGQHLVFFPDGKKLKGGEKDDMK
QVLGDVKECTKDQRSHLYKSADFNIKNELFHSEEYSASAEPKGNISKSFSLTDYLASEGQ
QLKPVSHSGNTSAKTINPQGATAGSLEVEEVTFSAVYDYYNPPLEYGRPLSPESEMSIEL
GSTFSDEMAEVERYYTPTSSTDNAQFPKSPESFHTPSETLGGFMTPPEYPISPLETKSTS
DSSDPFFSPVKLLRSPGDQCTETRPHVLSLDEGSFFTEGPSSLDMRVLQEKVQGIPPAFL
KPLTKKRLFEMETLRFCAEVFGLPSPDVKWFRNKTQLVADSRIKIERDGDNITLEIQNIS
KADQGEYICEASNYVGQAKSVALLMVLSQEARFMPAPPAVTHQHVIQFDVEDDDLSRSPS
PQEILLEVELDENDVKEFEKQVKIVTIPEYTADNKSMIISLDVLPSIYEENTVDFITEEN
DDLKIAFEVTEMPPRFINPICDVETLENCNIMFECSLMGIPSPIVTWFKGDKKVPHNDNK
YVHSSEGDNHFLRILKVNTGDSGIYACRAINVVGETICRATLLVLGSQMFSEKARGRELT
AVSLGSAKVQPQKFDLVVGNSSAEGEQTSEIELEFEFEQETDESQKAVRLIAMTNPGVSE
KGEKYVSIDLDVFAEPAKDDQIEFKAKSSETCSFQFQITEFPPKCVIPLENVTAALGTPV
VLQCLVTGKPHPNAEWYKDGMLIRTSRYIIQEKAPGHFNLIITNVNQDDAGEFKCVIRNK
AGFTETASLLKVF
NT seq 6882 nt NT seq  +upstreamnt  +downstreamnt
atgatttttcatggaggggaaatgggaaacgtgaagaccagaagagaaccacaagacact
tttttaggcacagaagactgcttagaacatggtcttgattcttctagttgtttctttatt
cacacacctattaatctgtcttgtgagaacattaagccttctttcaccaaaaaacttaaa
ttccagtctgtggtggaaggatgtcctgctatattcaagtgtaaaattatagctatccca
tctcccaaaattttatggtttcataacaataggccaattccaaaagagtgtcgccgtaaa
atacttagtgaaagcactatggatgtacatacttctagtttagtgattgaatgcgttaaa
gacaaagattcaggtagctacagagtaatggctattaacacagaaggatctgcagagtca
acagcttcccttctggtagctttaaaggaagaacaatatgcaaattatttaaactatgta
agacagtcaacaaagattcctcaaagcacggattctttggctgggcaaagaactgaaaga
aaggttagggttgatctgaggtgtgttggctctccatttgataaaaagtataagggatta
aaagggctgtctcgatcgaaacatacactaatgcgtactgtatactttagaacttcatct
acatctagaataccagacaaagtatcacttgaaacagcttctgagagagcacgttcccct
ccttccatgtttgaaaaatctgatagatttaatgaccgatttagtgatatttactgtgac
agatacactggtcgtgacagatttagtgacagatacagtgacagatggagtgacaggttc
agtgacacagaaagtctccatggggagataaaaacaaagttaaatattctacagaaagct
gtgaaaagaaaaaaacgactttcagtttcaacaatgtcatcatcagagtttgatgtagag
tcagtggctagtgagtcaagctacgcagactgttttgagcgcattaggatcaaaccaatc
tcattgcctgaagttcaacatgttgtcaggccatttgatcatggtgaacacagctttata
aaaacttcagcagactttcagaacagattggagagaattacgggccttgatatgcggaat
gtggaatcagaaaccacacatgtaaggcatacgtttgagccacagtcaagatccagagcc
attcaaatgatgaaagggaagcttctgaatgagcatgtccgagagatgggtgatgaagat
gtggaagactctgctctgaggaaggtggaggaagtatctgaagaaaggaatacacaaaca
caaaatgagtgtctactgtctgatgatcaagtaatttctcttaaagacacacacattaag
ttggaaaacccacagccacaatggtttgaagcagggaatttgtcaaacatgcttgagaga
tgtcacctgcctatttcaggttctgaagataatactaaagaaataattcaacaatatgaa
gactattcagttgagcaatctcaaagaaccaaacaagtcaacttatttaaagaaggactt
ctgggtgaagttgtcaaacaggaggataatatgaaaagtacaaaaccagagtctgactgt
aaagctatgttgaaggataccatttatgaaaagaatcttgaaattgatgtatcagagaat
gaagataaattcctaacattacgtattaggaaatggcaggaagatttacaactggaacat
gaagctgttcagctggaccctcattggactaaggataattcatcattcctgaagtctgag
ggtcccagtttaaagaaagtgacagacagagaaacaagtccagaaaaatatgaaacatca
ggtagaaaatcctctaaattaaaggcaacaagggcagcaaagcaaatgcccttcgagaag
ggtatttatgagcaacatttgagccgtgaaaacctttcgggcagggaaattgaaagtgca
cagtttgttagtgaaaaagaagctctggctcaacggataataaaatggcagcaagatgtt
ctgattgaacaagaagaagctgttgatgtggagactgattgggtagatacatactcagca
gaagcatctgagagaaaaaatgagttgagagaacaaggagaaactttggcacaaaatcag
gagtgtccagttgaaaaatcagctgcctttacatctgttcaagcagaaaccaagtgtgga
ctttcctcccatgatcataaagtagatagctttcagactgatcgtgaaataaagttcagt
gacgataatgaaattacattgaatgaaaacatatattttgccagtgaaaaagaagctatg
acccagcgaatgattaagtggcgacacgacattttgattgaacaggaagaagctgcagaa
ctggattcggattggactgcagtagatcaatctcagtacccaacaaaggagacagagaat
ttaacttttggtgttaaaggtagtgttaatgaagctactcagatccaggaaaaatcactt
aaattaccctatgaaacattacaggtgaaagacaaggatgttgtgcctaccattttgaca
cctcttgaagacattaataaatggaagagtgaatatttatcaagtgaagatcagtttgtt
gcccaacaatgtgggcaccagtatcaagatgtagtggctctgaaaaatacttctctgttt
gaatctgatttgactgagggcaagtgcattgtagatgatcagggaacagctgccaaaata
tttaataaaaaagtagatgaagcatatacaaactatcctccagttatcatgaagcaacta
atttctttggaagtgaagaaaggggagatgagtgaatttgtctgtcatttcaagggagac
cctgagcctactgttacttggtttaaagataagcaaccaattctacaaaatccagattat
gatatatgcaccaaaaagacagaatcaaaactaataatctgttatcccactactgatcat
cagggcacatattcatgtgctataactaataagtgtggaatgacaaaaagctctgccact
ctcataataattgaaagtccagaagtcaagaaacacccagaagttgcaaaggaagtccaa
gttacaacagtggaagagatggatgacgaacattttgagggaatgattgaaagggaactt
gagttgtacataaatccaaaatcagaagtgaaatcaactttacaggttccccagcttgtt
ctgcaaagatcacatgcagactcatctcttcattcttctcctgtggaaattaggatcaca
gcaccaacaccaattttagagttaagtgaggatatgaaagaatcatttgaacccattgaa
aaagttccagatatctcagatgaggacaatgttttgcaaacaaccaaacacaaatttaca
ttttcatttgagctttctgcagaagctcctcgggtagttaaggaactggaaaacctgatt
tgctctgagggccaaacagccatgcttgagtgcattgtgataggggagccagtccctaca
ataatgtggtttcatgatgattcagctttgaccactgctaacaccaagtacaggtttgaa
gataatggcaaaatatacagactgtatgttgataacttctcaagtttagatgtaggcaca
tataagctggttgctacaaacaaactagggcaagctgaaagcatagctaatgttttattt
gaaaattccaaagaaattactcccgcaatgaacacctcagaagtaagttcacaatgtagt
gtttatgtcagagctactgaagggatagatacagaaaaagacgccacaaaaattatggat
gtggttaatcagtttgaatgcccaagtcttgagtcagttcaaagtccttttgctttactt
gaaaatatggcacctcttcagaaggggaacaataccgatgagtttcaaggggagggaaaa
atgatacattcaaaagaagctacttccaacagaggagctgccataacaggctgtggattg
cagtcttcaggggcaattgtcaacatctcaaaaattaagcaggcatttgagccttctggc
ttgcctgagaatgctacaaagtgtgaattttctgaaccgtttttttctaagaaggagatg
ccaaagatagtaatcaatcctgtcgaaaaagagttaattcagtctgagatgaaagcatct
tctgaaaatattgcacatcaaatagaagatacaaataacctggagagagctactgacaaa
tatcattttgtttcattgtcaaatataaaagaagtttcgcagtcacatgaccttgtaaaa
ccagaagcagcaataccagtcttctgcaaaagtatgctggaaagagaggatgatgacttt
aaaaaatgtacaggagagaaaggaactgggaaaagtgttgatggtacatttgtaaaacaa
gtcagcagtatttcttctcttgagaaatcccaagaccagagctctgagcagtgttccgaa
ataactgatttaacttttaactctgagttagctgtggtaaaaccaaaacaaagtttcaca
ttaacatcatcatctttatggacaaaagaacaggatgtggagactgcttcactaggccag
caccttgttttctttcctgatggtaaaaaattgaaaggaggtgaaaaagatgatatgaaa
caagttcttggtgacgttaaggaatgcaccaaagatcaaagaagccacttgtacaagagt
gcagactttaacataaaaaatgaactttttcactcagaggaatactcagccagtgcagag
ccaaaaggaaatatcagtaaatcattttcattaacagattatcttgcatcagaaggccaa
caactgaagccagtgtctcactcaggaaacacatcagcaaagacgataaacccacagggt
gctactgcagggtctttagaagtggaagaggttaccttcagtgcagtttatgactattat
aatccaccactggaatatggaaggccattgtcaccagagtctgaaatgtctatagaattg
ggcagcacattcagtgatgaaatggcagaagttgaacgatactacacaccaacttcttca
acagataatgcacagtttccaaaatcacctgaatctttccacactccttctgagactcta
ggaggctttatgacacctccagaatatcctatttctcctcttgaaacaaaaagcactagt
gattcaagcgacccatttttttcaccagttaaacttctgagatccccaggagatcaatgc
actgaaacaagacctcacgtgcttagtcttgatgaggggagtttcttcacagagggaccc
agttcactggacatgagggttcttcaggaaaaagtccaaggaattcctccagcattcctt
aagccgttgactaaaaaaagactgtttgaaatggaaacactacgattttgtgctgaggtt
tttggattgccctctccagatgtgaaatggttcagaaataaaacacaactagtagcagat
agcaggattaaaatagaacgggatggggacaatatcactttagaaattcagaatataagc
aaggccgatcaaggagagtatatctgtgaagccagtaattatgttggacaagcaaaaagc
gttgctcttttgatggttttatctcaggaagccaggttcatgccagctcctcctgctgtt
acacatcaacacgtcatacaatttgatgttgaggacgatgacctatcacggtcaccttca
ccccaagaaattttactagaggtggagctggatgaaaatgatgtaaaagaatttgaaaaa
caggtgaaaatagtaactattcctgaatacacagctgacaataaaagcatgataatttcc
cttgatgttctacccagtatatatgaggaaaacacagtggatttcattacagaagaaaac
gatgacttgaaaattgcttttgaggttactgaaatgcccccacgttttataaatccaatt
tgtgatgtggagaccctagaaaattgcaatataatgtttgaatgttctttaatgggaatt
ccatcacccatagtgacatggtttaaaggagataaaaaagttcctcataatgataataaa
tatgttcattcatcagagggtgacaaccattttctcaggattttgaaagtcaacactggt
gatagtggcatatatgcttgcagagctataaatgttgtaggggaaacaatatgtagagct
acactgcttgtcttaggatctcaaatgttttcagaaaaggcaagagggagagagctgaca
gcagtgtctctaggaagtgccaaagtgcagccccagaaatttgatttagttgtaggaaat
tcttcagctgaaggggaacaaacatcagaaatagaattagagtttgagtttgagcaagaa
acagatgagtcacaaaaagctgttagacttattgcaatgactaatcctggggtgagtgag
aaaggggagaagtatgtgagtatcgatttagatgttttcgcagaaccagccaaagatgat
caaatagaattcaaagctaagtcatcagaaacatgcagttttcagtttcagattactgaa
tttccccccaagtgtgtcattcccttagaaaatgttactgcagctttagggacaccagtg
gtgctgcagtgtttagttactggaaaaccacacccaaatgcagagtggtataaagatggt
atgttgattagaacaagcaggtacataatccaagaaaaggcaccagggcactttaatttg
attatcacaaacgttaatcaagatgatgctggagagttcaagtgtgttatccgaaacaaa
gcaggatttactgaaacagcttctctgctgaaagtattttga

DBGET integrated database retrieval system