KEGG   Scleropages formosus (Asian bonytongue): 114909360
Entry
114909360         CDS       T04919                                 

Definition
(RefSeq) retinol dehydrogenase 7-like
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Pathway
sfm00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:sfm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    114909360
Enzymes [BR:sfm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     114909360
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR CcmD Epimerase
Other DBs
NCBI-GeneID: 114909360
NCBI-ProteinID: XP_029103801
Position
22
AA seq 329 aa
MCSPVCSMEHLWMYAAAVLLLLWLLVWLWRDSLVISDIGENYVFVTGCDSGFGNLLCKRL
DRRGFRVLAGCLTEKGADNLRRATGPKLKTILLDVTDSSSIRRAMEWTKKEVGDRGLWGL
VNNAGRSLPMGPTEWMRMEDFHSTLRVNMMGVIEMTMTFLPLLKKGRGRVVNVASVLGRV
AANGGGYCISKFAVESFSDCLRRDIHYFGIKVSIIEPGFFKTAVTSLEPIERELHRLWNQ
LSPEVRDSYGEKYFDRYIKVQRLIMNMLCDPDLSKVTNCMEHALTAQYPRTRYSAGWDAK
FAWIPLSYAPACLLDFFLRTVLPRPAQSV
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtgctctcctgtgtgcagcatggagcacctgtggatgtatgcagcggctgtgctgctg
ctgctctggctgctggtgtggctgtggagagatagcctggtcatctcagacatcggtgaa
aactatgtctttgtgactggctgtgactcgggctttgggaacctgctgtgcaagcggctg
gaccgccgcggcttccgcgtgctggccggctgtttgacggagaagggcgcggacaaccta
cgccgggcgacagggcccaagctgaagaccatcctgctggatgtgacggacagcagcagt
atccgtcgggccatggagtggacaaagaaggaagtgggtgacagaggtctgtggggcctc
gtgaacaacgcgggccggtcccttcccatgggccccacggagtggatgcggatggaggac
ttccacagcacgctgcgagtcaacatgatgggcgtcattgagatgacgatgaccttcctg
ccactgctgaagaaaggccgggggcgggtggtcaacgtggcgtccgtcctgggccgtgtg
gccgctaacggtggcgggtattgcatctcgaaatttgcagtggagtccttctctgactgc
ctcaggagggacatacactactttggcatcaaggtgagcatcatcgagccgggcttcttc
aagacagcggtgaccagcctggagccaatcgagagggagctgcaccgcctgtggaaccag
ctgagcccagaggtgcgggacagctatggggagaagtactttgacaggtatatcaaggtc
cagcggttgatcatgaacatgttgtgtgacccggacctgagcaaggtgacaaactgcatg
gagcacgctttgacagcacagtacccccgaacgcgttacagcgctggctgggacgcaaag
ttcgcatggattcccctgtcctacgcccctgcctgtctgctggacttcttccttaggact
gtgctaccgcgtccggcgcagagcgtctag

DBGET integrated database retrieval system