KEGG   Shigella flexneri 2003036: SFy_1115Help
Entry
SFy_1115          CDS       T03267                                 

Definition
(GenBank) YbjU
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
sfn  Shigella flexneri 2003036
Pathway
sfn00260  Glycine, serine and threonine metabolism
sfn01100  Metabolic pathways
sfn01110  Biosynthesis of secondary metabolites
sfn01120  Microbial metabolism in diverse environments
sfn01130  Biosynthesis of antibiotics
sfn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SFy_1115
Enzymes [BR:sfn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SFy_1115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 CheD
Motif
Other DBs
NCBI-ProteinID: AIL34813
Position
complement(835708..836709)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQ
ANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKI
KPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMAGGGMRQSGILAAAGMY
ALENNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVL
INASPIVRLVTHLDVSREQLAEVAAHWRAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgaccgagccgcgccatgctcgaagcgatg
atggccgccccggttggggacgacgtttacggagacgaccctaccgttaatgctctgcag
gactatgcagcagagctttccggtaaagaagccgccatttttctgcctaccggcactcag
gccaacctggtcgctctgctcagtcactgcgaacgtggcgaagagtatattgtcggtcag
gccgcgcataactatctgtttgaagccggtggcgcagcggtgctgggcagtattcagccg
caacccatcgacgcggctgccgacggcacgctaccgctggataaagtggcgatgaaaatc
aaacccgacgatatccatttcgcccgcaccaaattactcagtctggaaaacacccacaac
ggcaaagtgctgccgcgtgaatacctgaaagaagcatgggaatttacccgcgagcgcaat
ctggcgctgcatgttgacggtgcgcgcatctttaatgccgtggtggcttacggctgcgaa
ctgaaagagatcacgcaatattgtgattcgttcaccatttgcctgtcgaaaggtcttggg
acgccagtcggttcattactcgtcggtaatcgtgattacattaaacgtgccatccgctgg
cggaaaatggccggtggcgggatgcgtcagtccgggattctggctgccgccgggatgtat
gccctggaaaataacgtcgcacggttgcaggaagatcacgacaacgccgcctggatggcg
gagcaactgcgtgaagcaggcgcggatgtgatgcgtcaggacactaatatgctgtttgtt
cgcgtcggggaagaaaatgctgccgcgttaggcgaatacatgaaagcgagaaacgtgctg
attaacgcctcgccgattgtccgcctggtgacgcatcttgacgtctcgcgcgaacaactg
gcggaagtcgccgcccactggcgcgcattcctggcgcgttaa

DBGET integrated database retrieval system