KEGG   Shigella flexneri 2003036: SFy_2571Help
Entry
SFy_2571          CDS       T03267                                 

Definition
(GenBank) AldA
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
sfn  Shigella flexneri 2003036
Pathway
sfn00620  Pyruvate metabolism
sfn00630  Glyoxylate and dicarboxylate metabolism
sfn01100  Metabolic pathways
sfn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SFy_2571
   00630 Glyoxylate and dicarboxylate metabolism
    SFy_2571
Enzymes [BR:sfn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     SFy_2571
    1.2.1.22  lactaldehyde dehydrogenase
     SFy_2571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF2800
Motif
Other DBs
NCBI-ProteinID: AIL35961
Position
complement(1851585..1853000)
Genome map
AA seq 471 aa AA seqDB search
MYIDGQFVTWRGDAWIDVVNPATEAVISRIPDGQAEDARKAIDAAERAQPEWEALPAIER
ASWLCKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWARRYEGEIIQ
SDRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEFTPNNAIAF
AKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMATAAKNITKV
CLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKGIYDQFVNLLGEA
LQAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVALGGKAVEGKGYYYPPT
LLLDVRQEMSIMHEETFGPVLPVVAFDTLEDAISMANDSDYGLTSSIYTQNLNVAMKAIK
GLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQS
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtatatcgatggacagtttgttacctggcgtggagacgcatggattgatgtggtaaac
cctgctacagaggctgtcatttcccgcatacccgatggtcaggccgaggatgcccgtaag
gcaatcgatgcagcagaacgtgcacaaccagaatgggaagcgttgcctgctattgaacgc
gccagttggttgtgcaaaatctccgccgggatccgcgaacgcgccagtgaaatcagtgcg
ctgattgttgaagaagggggcaagatccagcagctagctgaagtcgaagtggcttttact
gccgactatatcgattacatggcggagtgggcacggcgttacgagggcgagattattcaa
agcgatcgtccgggagaaaatattcttctgtttaaacgtgcgcttggtgtgactaccggc
attctgccgtggaactttccgttcttcctcattgcccgcaaaatggctcccgctcttttg
accggtaataccatcgtcattaaacccagtgaatttacgccaaacaatgcgattgcattc
gccaaaatcgtcgatgaaataggccttccgcgcggcgtgtttaaccttgtactggggcgt
ggtgaaaccgttgggcaagaactggcgggtaacccaaaggtcgcaatggtcagtatgaca
ggcagcgtctctgcaggtgagaagatcatggcgactgcggcgaaaaacatcaccaaagtg
tgtctggaattgggtggtaaagcaccggctatcgtaatggacgatgccgatcttgaactg
gcagtcaaagccatcgttgattcacgcgtcattaatagtgggcaagtgtgtaactgtgca
gaacgtgtttatgtacagaaaggcatttatgatcagttcgtcaatctgctgggtgaagcg
ttgcaggcggttcaatttggtaaccccgctgaacgcaacgacattgcgatggggccgttg
attaacgccgcggcgctggaaagggttgagcaaaaagtggcgcgcgcagtagaagaaggg
gcgagagtggcgttgggtggcaaagcggtagaggggaaaggatattattatccgccgaca
ttgctgctggatgttcgccaggaaatgtcgattatgcatgaggaaacctttggcccggtg
ctgccagttgtcgcatttgacacgctggaagatgctatctcaatggctaatgacagtgat
tacggcctgacctcatcaatctatacccaaaatctgaacgtcgcgatgaaagccattaaa
gggctgaagtttggtgaaacttacatcaaccgtgaaaacttcgaagctatgcaaggtttc
cacgccggatggcgtaaatccggtattggcggcgcagatggtaaacatggcctgcatgaa
tatctgcagacccaggtggtttatttacagtcttaa

DBGET integrated database retrieval system