KEGG   Shigella flexneri 2003036: SFy_4064Help
Entry
SFy_4064          CDS       T03267                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sfn  Shigella flexneri 2003036
Pathway
sfn00071  Fatty acid degradation
sfn00280  Valine, leucine and isoleucine degradation
sfn00310  Lysine degradation
sfn00362  Benzoate degradation
sfn00380  Tryptophan metabolism
sfn00620  Pyruvate metabolism
sfn00630  Glyoxylate and dicarboxylate metabolism
sfn00640  Propanoate metabolism
sfn00650  Butanoate metabolism
sfn00900  Terpenoid backbone biosynthesis
sfn01100  Metabolic pathways
sfn01110  Biosynthesis of secondary metabolites
sfn01120  Microbial metabolism in diverse environments
sfn01130  Biosynthesis of antibiotics
sfn01200  Carbon metabolism
sfn01212  Fatty acid metabolism
sfn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SFy_4064
   00630 Glyoxylate and dicarboxylate metabolism
    SFy_4064
   00640 Propanoate metabolism
    SFy_4064
   00650 Butanoate metabolism
    SFy_4064
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SFy_4064
   00072 Synthesis and degradation of ketone bodies
    SFy_4064
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SFy_4064
   00310 Lysine degradation
    SFy_4064
   00380 Tryptophan metabolism
    SFy_4064
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SFy_4064
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SFy_4064
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SFy_4064
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfn04147]
    SFy_4064
Enzymes [BR:sfn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SFy_4064
Exosome [BR:sfn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SFy_4064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-ProteinID: AIL37127
Position
complement(2946658..2947839)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGEQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMIQSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgtggtgcg
ttagcgggtcattccgccgtggaacttggtagtctggtcgtgaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaaggcaatcggctattaaaggtggtcttcctaacagcgtttct
gcaatcacgattaatgacgtttgcggttccggtcttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgcaggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggtgaacagcttggcaatagccagttggtt
gacagtctggtgcatgatgggttgtgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcagttgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaatgatccaaagtaacggtcagacgttggttgttgataccgatgaacagccacgc
actgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggttct
gtgaccgcggggaatgcatcatccataaacgatggcgcagctgcggtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcatccgcgcatttgccagc
gttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgtaggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtcaat
ggtggcgcgatcgcactcggtcacccgataggcgcttccggttgccgaatcctggtttct
ctggttcatgaaatggtgaaacgtaatgcccgcaaagggctggcaacgctttgtatcggc
gggggccagggcgtggcattgaccattgaacgtgacgagtag

DBGET integrated database retrieval system