KEGG   Shigella flexneri 2003036: SFy_4079
Entry
SFy_4079          CDS       T03267                                 

Definition
(GenBank) aldehyde oxidase and xanthine dehydrogenase, molybdopterin binding domain protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
sfn  Shigella flexneri 2003036
Pathway
sfn00230  Purine metabolism
sfn01100  Metabolic pathways
sfn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SFy_4079
Enzymes [BR:sfn01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     SFy_4079
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AIL37140
Position
2961200..2963149
AA seq 649 aa
MARDELTAEKAAQLVSIEWQELPVITTPEAALTEDAAPIHNGGNLLKQSTMSTGNVQQTI
DAADYQVQGHYQTPVIQHCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPW
SCVRVIKPFVGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTID
GQMGVNRDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNL
PSAGAMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRICSAGL
PECLEKGRKIFEWEKRRAECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDG
TINVQSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVA
APALRSAALLLKEKIIAHAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYH
PERGGQLSAESSIKTTTNPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEG
QVHGGMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAY
GHKSLGEPPIIPVAAAIRNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 1950 nt   +upstreamnt  +downstreamnt
gtggcccgcgatgaactcacggcagaaaaagcggcgcaattggtcagcattgagtggcaa
gaattacccgttatcaccacgccagaagcggcgctgacagaagacgctgcaccaatccat
aacggcggcaatttactgaaacaaagcacgatgtcgacgggcaatgtccaacaaacaatc
gatgccgccgactaccaggtacaggggcactatcagactcccgttattcaacattgtcac
atggaaagcgtaacatcgctggcgtggatggaggatgactcgcgaattaccatcgtttcc
agcacccagatcccgcacattgttcgccgcgtggttggtcaggcgctggatattccctgg
tcatgcgtacgagtcatcaaaccgtttgtcggtggcggttttggtaataaacaggatgta
ctggaagagccaatggcggcattcctgaccagcaagcttggcggcattccggtgaaagtt
tcccttagccgtgaagagtgtttcctcgcaacccgtacccgccacgcttttactattgac
gggcaaatgggcgtgaaccgcgacggaaccttgaaaggttatagtctggatgttctgtct
aacaccggcgcttatgcatctcacgggcactccatcgcttctgcgggggggaataaagtc
gcttacctttatcctcgttgtgcctacgcttacagttcaaagacctgctataccaacctc
ccctcggctggtgcgatgcgtggttatggcgcgccacaagtcgtatttgccgttgagtct
atgcttgatgacgccgcgacagcgttaggtattgatcctgttgaaattcgtttacgcaac
gccgcccgcgaaggagatgctaatccgctcacgggcaaacgtatttgcagcgcagggttg
ccggagtgtcttgaaaaaggccggaaaatctttgaatgggaaaaacgccgtgcagaatgc
cagaaccagcaaggcaatttgcgccgcggcgttggcgtcgcctgttttagctacacctct
aacacctggcctgtcggcgtagaaatagcaggcgcgcgccttctgatgaatcaggatgga
accatcaacgtgcaaagcggcgcgacggaaatcggtcagggtgccgacaccgtcttctcg
caaatggtggcagaaaccgtgggggttccggtcagcgacgttcgcgttatttcaacacaa
gataccgacgttacgccgttcgatcccggcgcatttgcctcacgccagagctatgttgcc
gcgcctgcgctgcgcagtgcggcactattattaaaagagaaaatcatcgctcacgccgca
gtcatgctacatcagtcagcgatgaatttgaccctgataaaaggccatatcgtgctggtt
gaacgaccggaagagccgttaatgtcgttaaaagatttggcgatggacgctttctaccac
cctgaacgcggcgggcagctctctgctgaaagctccatcaaaaccaccactaacccaccg
gcgtttggctgtacctttgttgatctgacggtcgatattgcgctgtgcaaagtcaccatc
aaccgcatcctcaacgttcatgattcagggcatattcttaatccactgctggcagaaggt
caggtacacggcggaatgggaatgggcattggctgggcgctatttgaagagatgatcatc
gatgctaaaagcggcgtggtccgtaaccccaatctgctggattacaaaatgccgaccatg
ccggatctgccacaactggaaagcgcgttcgtcgaaatcaatgagccgcaatccgcatac
ggacataagtcactgggtgagccacccataattcctgttgccgctgctattcgtaacgcg
gtgaagatggctaccggtgttgcaatcaatacactgccgctgacgccaaaacggttatat
gaagagttccatctggcaggattgatttga

DBGET integrated database retrieval system