KEGG   Shigella flexneri 2003036: SFy_6117Help
Entry
SFy_6117          CDS       T03267                                 

Definition
(GenBank) YtfR
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
sfn  Shigella flexneri 2003036
Pathway
sfn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sfn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SFy_6117
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfn02000]
    SFy_6117
Enzymes [BR:sfn01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     SFy_6117
Transporters [BR:sfn02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    SFy_6117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_16 AAA_30 AAA_23 RsgA_GTPase AAA_22 ABC_ATPase MMR_HSR1 DUF2813 AAA_15 TsaE DUF815 DLIC FeoB_N
Motif
Other DBs
NCBI-ProteinID: AIL38651
Position
complement(4424608..4426110)
Genome map
AA seq 500 aa AA seqDB search
MTTDQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYH
ADRGTIWLEGQTISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPKRFGLLRRK
EMEKRATELMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQE
MELLFGLMRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNGSFVGCRETRELPQIELVKM
MLGRELDTHALQRAGRTLLSDKPVAAFKNYGKKGTIAPFDLEVRPGEIVGLAGLLGSGRT
ETAEVIFGIKPADSGTALIKGKPQTLRSPHQASVLGIGFCPEDRKTDGIIAAASVRENII
LALQAQRGWLRPISRKEQQEIAERFIRQLGIRTPSTEQPIEFLSGGNQQKVLLSRWLLTR
PQFLILDELTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMRDRKQ
VAEIPLAQLSVPAIMNAIAA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgaccaacaccaggagatcctccgcaccgaaggattaagtaaatttttcccc
ggcgtcaaagcgttagacaacgttgatttcagcctgcgccgtggcgaaatcatggcgctg
cttggtgaaaacggggcgggaaaatcaacgctaatcaaagcattaactggtgtataccac
gccgatcgcggcaccatctggctggaaggccagactatctcaccgaaaaataccgcccat
gcacaacaactcggtatcggcaccgtctatcaggaagtcaacctgctacccaatatgtcg
gttgctgataatctattcataggtcgcgaacccaaacgtttcggccttctacgccgtaaa
gagatggaaaagcgcgccaccgaactgatggcatcttacggtttctccctcgacgtgcgc
gaaccgcttaaccgtttttcggtggcgatgcagcaaatcgtcgccatttgccgggctatc
gatctctccgccaaagtgctgatcctcgatgaacccaccgccagcctcgacacccaggaa
atggagctattatttggcctgatgcgtcagttgcgcgatcgcggcgtcagcctgatcttt
gtcactcactttctcgatcaggtctatcaggtcagcgatcggatcaccgtcttacgcaac
ggcagtttcgtaggctgtcgggaaacgcgcgagctaccgcagatcgaactggtaaaaatg
atgctggggcgcgagctggatacccacgcgctacagcgtgccgggcgaacattgttgagc
gacaaacccgttgccgcgttcaaaaattacggcaaaaaaggaacgatagcaccgtttgat
ctcgaagtgcgccccggcgagatcgtcggtctggctggcttgctgggatccggacgtacc
gaaaccgccgaagtgatcttcggtatcaaacctgctgacagcggcacggcgttgatcaaa
ggcaaaccgcaaaccctgcgatcgccacatcaggcttcagtactgggcatcggattctgc
ccggaagacaggaaaaccgatggcatcatcgccgccgcctcggtgcgggaaaatatcatc
ctcgctctccaggcccagcgcggctggctacgacccatttcccgcaaagagcagcaagag
attgccgaacgctttatccgccagcttggcattcgcacaccttcaactgaacaaccgatt
gaatttctctccggtggcaatcagcaaaaagtgctgctttcacgttggctactgacccga
ccgcaatttctgatccttgatgagctaacccgtggcattgatgttggtgcccacgccgag
atcatccgcctgattgaaacgctgtgtgctgacggtctggcgctgctggtgatctcctcc
gaactggaagagctggtgggctatgccgaccgggtgatcatcatgcgcgatcgcaaacag
gtggcggagatcccgctggcacagctttccgttccggcgatcatgaacgccattgcggcg
taa

DBGET integrated database retrieval system