KEGG   Chania multitudinisentens: Z042_03505Help
Entry
Z042_03505        CDS       T02987                                 

Definition
(GenBank) amino acid ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
sfo  Chania multitudinisentens
Pathway
sfo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Z042_03505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfo02000]
    Z042_03505
Transporters [BR:sfo02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    Z042_03505
   Histidine transporter
    Z042_03505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AHG18776
UniProt: W0L4Y0
Position
2796696..2797382
Genome map
AA seq 228 aa AA seqDB search
MLQGYSQLIFEGALVTLKLALSSVFLALVIGLIGAGGKLSQNRVVAMIFGAYTTLIRGVP
DLVLMLLIFYGLQIVLNNLTEMLGFSQIDIDPLSAGIITLGFIYGAYFTETFRGAYLAVP
RGQIEAATAFGLSGSQIFRRILFPAMMRFALPGIGNNWQVILKATALVSILGLSDLVKAT
QLAGKGTYQPFFYALVAGMVYLFFTTVSNGVLLWLERRYSLGVKRAEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaggctattcccaactgatattcgagggcgctctggttacgctgaagctggcc
cttagttctgtttttctggcgctggtgattggcttaatcggtgccggtggcaaactttcg
caaaatcgcgttgtcgccatgatatttggtgcctataccacgctgattcgtggtgtgccg
gatctggtgctgatgttgctgatcttctacggcctacagattgtcttgaacaacctcact
gaaatgctcggtttctctcagattgatattgatccgttaagcgcggggattattaccctg
ggttttatctacggtgcttattttaccgaaactttccgtggtgcctatttggcggttccc
cgcgggcagatcgaagcagcgacggctttcgggctttccggtagccagattttccgccgg
atcttgtttccggcgatgatgcgttttgccttacccggcattggcaataactggcaggtg
atcctgaaagccacggcgttggtatcgattcttggcctgagcgatttggttaaagcgaca
cagttggccggtaagggcacctaccaacctttcttttacgcgctggttgcgggcatggtg
tacctgttctttactaccgtttccaatggcgtgttgctatggcttgagcggcgttattca
ctgggtgtgaaaagggccgaattatga

DBGET integrated database retrieval system