KEGG   Chania multitudinisentens: Z042_06075Help
Entry
Z042_06075        CDS       T02987                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
sfo  Chania multitudinisentens
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sfo03009]
    Z042_06075
Enzymes [BR:sfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     Z042_06075
Ribosome biogenesis [BR:sfo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Z042_06075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN MIT_C
Motif
Other DBs
NCBI-ProteinID: AHG19233
UniProt: W0L5Z7
Position
2220059..2221159
Genome map
AA seq 366 aa AA seqDB search
MNKLALYCRPGFEKECAAEITDKAAQLEIFGFARVKENSGYVLFECYQPDDADRLAKEIP
FRELIFARQMIVVGELLRDLPPEDRVSPIVGMLIGVVDRGGELRVEVPDTNESKELMKFC
RKLTVPLRAAMREQKVLMARENATRPVVHVFFIAPGCCYVGYSYSKNNSPFYMGIPRLKF
PADAPSRSTLKLEEAFHVFIPADEWDERLGSGMYAVDLGACPGGWTYQLVKRSMMVHAVD
NGTMAQSLMETGQVTHHRADGFKFEPTRNNIYWLVCDMVEKPARVTSLVINWLLKGWCRE
AIFNLKLPMKKRYEEVSQNLQSIQEALATADISAEIHAKQLYHDREEITVHVRRMWSAIP
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataagctcgcgttgtactgccgccctggttttgaaaaagagtgtgcggcagaaatc
actgacaaagccgcccagttggaaatattcggctttgcacgagtcaaagaaaacagcggt
tacgtgctgtttgaatgctatcaaccagacgatgccgatcgtttggcgaaagaaatcccg
ttccgtgagctgattttcgctcgtcagatgattgtggttggggaactgctgcgtgacttg
ccgccggaagatcgggtgtcgccgattgtcgggatgctgattggtgtggttgatcgcggt
ggtgaactgcgggtagaagtaccggataccaacgaaagcaaagaactgatgaagttttgc
cgcaagctgacggtgcctttgcgcgctgccatgcgcgaacagaaagtgctgatggcgcgt
gaaaacgcaacgcgtccggtagtgcatgtgttctttatcgctccaggttgctgctatgtg
gggtattcctacagtaaaaataactctccattctatatggggattccgcgtcttaagttc
ccggcggatgcgccaagccgctctacattgaagttggaagaggctttccatgtgtttatt
ccagccgacgaatgggatgagcgtttgggcagcggcatgtatgcggttgatttaggggct
tgccctgggggatggacctatcaactggttaaacgcagcatgatggtacatgccgtagat
aacggtactatggctcagagcctgatggagactgggcaggtgacccaccaccgtgctgac
ggcttcaagtttgaacccacgcgtaacaatatctactggctggtgtgcgatatggtagaa
aaaccggcgcgagtgacaagcctggtgattaattggctgcttaagggttggtgccgtgag
gcaatcttcaatttgaagctaccgatgaagaaacgctatgaagaggtttcacagaatctg
caaagtattcaggaagccttggcgacagcggatatcagcgcagagattcatgccaagcag
ctgtatcatgatcgtgaagagatcaccgtacatgtgcgccgcatgtggtctgctattcca
ggccgccgcgacgagcgttga

DBGET integrated database retrieval system