KEGG   Chania multitudinisentens: Z042_06655Help
Entry
Z042_06655        CDS       T02987                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
sfo  Chania multitudinisentens
Pathway
sfo00260  Glycine, serine and threonine metabolism
sfo00630  Glyoxylate and dicarboxylate metabolism
sfo00670  One carbon pool by folate
sfo01100  Metabolic pathways
sfo01110  Biosynthesis of secondary metabolites
sfo01130  Biosynthesis of antibiotics
sfo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Z042_06655 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Z042_06655 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Z042_06655 (gcvT)
Enzymes [BR:sfo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Z042_06655 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: AHG19333
UniProt: W0L699
Position
2082236..2083333
Genome map
AA seq 365 aa AA seqDB search
MAKQTPLYEQHVACGARMVDFHGWMMPLHYGSQLDEHHVVRQDAGMFDVSHMTIVDLHGA
RTREFLRYLLANDVAKLTQSGKALYSGMLNASGGVIDDLIVYFFTEDFFRLVVNSATRDK
DLAWIAQHAAPYSVELTVRDDLALIAVQGPQAKQRIATLFTPEQKQAVAGMKPFFGVQAG
DLFIATTGYTGEAGYEIALPKEQAVDFWQRLLAAGVKPAGLGARDTLRLEAGMNLYGQEM
DEGISPLAANMGWTIAWEPQERQFIGRSALEQQRERGTEQLVGLIMTEKGVLRNELPVRF
TDATGQTHEGVITSGSFSPTLGYSIALARVPTGIGEQAVVQIRNREMPVKVIKPGFVRAG
KSLIN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcaaaccccactgtacgagcagcatgtggcctgtggtgcgcgtatggtcgat
tttcatggctggatgatgccgctgcattacggctctcagcttgatgaacaccacgttgtg
cgccaggatgccgggatgtttgatgtctcccacatgaccatcgtggatctgcacggtgcc
cgtacccgtgaattcctgcgttacctgttggcaaatgatgttgccaaactcactcaatca
ggcaaggcgctgtatagcggcatgctgaatgcgtccggcggcgtgattgacgatctgatc
gtttacttctttactgaagactttttccgcctggtggtgaactctgccacgcgcgacaaa
gacctggcctggatcgcccaacatgctgcaccgtacagcgttgaattaacggtgcgcgac
gatctggcgctgatcgcggtgcaaggcccacaggctaaacaacgcattgccaccttgttt
accccagagcaaaagcaggccgtggcgggaatgaaacctttctttggcgtgcaggctggg
gatctgtttattgctaccaccggttataccggtgaggctggttacgaaattgccctgcca
aaagaacaggcggttgatttctggcagcgactgctggctgctggcgtcaagcccgcaggg
ctgggcgcgcgtgacacactgcggctggaagccggtatgaacctttacgggcaggaaatg
gatgaggggatttccccgctggccgccaatatgggctggaccatcgcctgggagccgcaa
gagcgccagtttattggccgcagcgcgttggaacagcaacgcgagcggggcactgaacaa
ctggtcggcttgatcatgacggaaaaaggtgtattacgtaatgagctgccggtgcgtttt
accgatgcaactggccaaacccatgaaggggtgattaccagtggctccttctcaccaacg
ttgggctacagtattgcattggcgcgtgtgcctacggggattggcgaacaggccgttgtg
cagatccgtaaccgtgaaatgccagtgaaagtgatcaaaccaggttttgtgcgtgccggt
aagtcactgattaattga

DBGET integrated database retrieval system