KEGG   Chania multitudinisentens: Z042_10245Help
Entry
Z042_10245        CDS       T02987                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
sfo  Chania multitudinisentens
Pathway
sfo00010  Glycolysis / Gluconeogenesis
sfo00020  Citrate cycle (TCA cycle)
sfo00620  Pyruvate metabolism
sfo01100  Metabolic pathways
sfo01110  Biosynthesis of secondary metabolites
sfo01120  Microbial metabolism in diverse environments
sfo01130  Biosynthesis of antibiotics
sfo01200  Carbon metabolism
Module
sfo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Z042_10245
   00020 Citrate cycle (TCA cycle)
    Z042_10245
   00620 Pyruvate metabolism
    Z042_10245
Enzymes [BR:sfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Z042_10245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AHG19974
UniProt: W0LC62
Position
complement(1328656..1330275)
Genome map
AA seq 539 aa AA seqDB search
MRVKGITHQDLAAYGIHNVGEIVHNPSYELLFKEETDPSLEGFERGVVTHLGAVSVDTGI
FTGRSPKDKYIVRDDITRNTVWWADQGKGKNDNKPLSPEVWANLKQLVTEQLSGKRLFVV
DTFCGANADTRLKVRFITEVAWQAHFVKNMFIRPSDEELQNFEPDFVVMNGAKCTNPNWQ
QQGMNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSIMNYLLPLKGIASMHCSANVGEKG
DVAVFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDDGVFNFEGGCYAKTIKLSEQAEPDIY
HAIKRDALLENVTVLADGTVDFNDGSKTENTRVSYPIYHIQNIVKPVSKAGHATKVIFLT
ADAFGVLPPVSRLTANQTQYHFLSGFTAKLAGTERGVTEPTPTFSACFGAAFLSLHPTQY
AEVLVKRMQAAGAQAYLVNTGWNGTGKRISIQDTRGIIDAILNGEIDKAETITLPIFDLA
MPTALPGVDPAILDPRATYATVAQWEEKAHDLANRFITNFDKYTDTPAGAALVSAGPKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgttaaaggtataacccaccaggatcttgccgcctatgggatccataacgttggt
gaaatcgttcacaatccaagttatgaattattgttcaaagaagaaaccgatccttcactg
gaagggtttgagcgcggtgttgttactcatctgggagccgtttctgtcgataccggtatt
tttaccggtcgctctccaaaagataagtatattgtccgtgatgatattacccggaacacc
gtctggtgggcagatcagggtaaaggcaagaatgataacaaacctctcagccctgaagtc
tgggccaatctgaagcaactggtcaccgagcaactttccggcaagcgtttgtttgtggtg
gatactttttgtggcgccaacgctgacacccgtctgaaagtgcgctttattaccgaagtc
gcctggcaggcgcactttgtgaaaaacatgttcatccgcccaagcgatgaagaactgcaa
aattttgaacccgactttgtggtaatgaacggtgccaaatgcaccaatccgaattggcag
caacaggggatgaattcggaaaacttcgtcgcgttcaacctgactgaacgtatgcagttg
atcggcggcacctggtacggcggcgaaatgaagaaagggatgttctctataatgaactac
ctgctgccgctgaaaggcattgcctccatgcactgctcggccaacgtgggcgagaaaggt
gatgtagcggtgttctttggcctgtccggcacaggtaaaaccacgctctccaccgatccg
aagcgccaattgatcggcgacgacgaacacggctgggacgatgatggagtcttcaacttc
gaagggggctgctacgccaaaaccatcaagctttccgaacaagcagagccagatatctat
cacgctattaagcgcgatgcattactggaaaacgtgaccgtactggccgatggcacggtc
gatttcaacgacggttcgaaaaccgagaacacccgcgtttcttatccgatctaccacatc
cagaatatcgttaaaccggtttcaaaagccggccatgccaccaaggtgatcttcctgacc
gccgatgcttttggcgtattgcccccggtatcacgcctaacggccaaccagacccaatac
cacttcctgtccggtttcacagcgaagctggcaggtaccgagcgtggcgtcaccgagcca
accccaaccttctccgcttgttttggtgcagctttcctgtcgctgcacccgacgcaatat
gcagaagtcctggtcaaacgtatgcaagcagctggagcgcaggcttatctggtaaatacc
ggttggaacggcactggcaagcgtatctcgatccaagatacccgtggcattattgatgcc
atccttaatggtgaaatcgacaaagcggaaactattacgctgccgattttcgatctggcg
atgccaaccgccttaccgggcgttgatccggccatcctcgacccacgggccacctatgcc
accgtggcacaatgggaagagaaagcgcacgatctggcgaatcgctttatcaccaatttt
gataaatacacggataccccagcgggtgcagcactggtcagcgcggggccgaaactgtaa

DBGET integrated database retrieval system