KEGG   Chania multitudinisentens: Z042_11280Help
Entry
Z042_11280        CDS       T02987                                 

Definition
(GenBank) fructose 1,6-bisphosphatase
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
sfo  Chania multitudinisentens
Pathway
sfo00010  Glycolysis / Gluconeogenesis
sfo00030  Pentose phosphate pathway
sfo00051  Fructose and mannose metabolism
sfo00680  Methane metabolism
sfo01100  Metabolic pathways
sfo01110  Biosynthesis of secondary metabolites
sfo01120  Microbial metabolism in diverse environments
sfo01130  Biosynthesis of antibiotics
sfo01200  Carbon metabolism
Module
sfo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Z042_11280
   00030 Pentose phosphate pathway
    Z042_11280
   00051 Fructose and mannose metabolism
    Z042_11280
  09102 Energy metabolism
   00680 Methane metabolism
    Z042_11280
Enzymes [BR:sfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Z042_11280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AHG20141
UniProt: W0L8S3
Position
complement(1077636..1078646)
Genome map
AA seq 336 aa AA seqDB search
MKRELAIEFSRVTEAAALAGYKWLGRGDKNAADGAAVNAMRIMLNKVDINGRIVIGEGEI
DEAPMLYIGEQVGTGQGDAVDIAVDPIEGTRMTAMGQSNALAVLAVGDRGTFLHAPDMYM
EKLVVGPQARGVIDLNLPLAENLHNIAVSLGKPLAELTVITLAKPRHDAVIAQMQQLGVK
VFAIPDGDVAASILTCMPDSEVDVMYGIGGAPEGVVSAAVIRALDGDMQARLLPRHQVKD
DNEENRRIGEQELARCKEMGIEAGKVLVLDEMARNDNVIFSATGITKGDLLEGITRKGNM
ATTETLLIRGKSRTIRRIRSTHYLDRKDAALHEFLL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaattagccatcgaattttcccgcgttaccgaagccgccgctctggcgggt
tacaagtggttaggccgcggcgacaaaaatgctgctgatggtgccgccgtcaatgccatg
cgcattatgctcaataaagtggatatcaatggccgtattgtgatcggtgaaggcgagatt
gatgaagccccaatgctgtacatcggtgagcaagtcgggactggccagggtgatgccgtc
gatatcgctgtcgatcccatcgaaggtacccgaatgaccgccatgggccaatccaacgca
ctggcagtgctggcggtgggcgatcgtggcactttcctgcacgcgcctgatatgtatatg
gagaagctggtggttggcccacaggcgcgtggcgttatcgacctcaacctgccgctggca
gaaaacctgcacaacatcgcggtaagtctgggaaaaccgctggcagaactgacggtgatc
actctggcaaaaccgcgccacgacgcggtgatcgcccagatgcagcagcttggcgtgaaa
gtattcgctatccctgacggcgacgtcgcggcctctattctgacctgtatgccggacagt
gaagtagatgtgatgtacggcattggcggcgcaccggaaggtgtggtgtctgccgcggtg
atccgcgccctggacggcgatatgcaggccagactactgccacgccatcaggtaaaggac
gataacgaagaaaatcgccgtattggtgaacaggaattggctcgttgcaaagagatgggc
atcgaagcgggtaaggtgctggttttggatgaaatggcacgcaacgataacgtgatcttt
tctgcgaccggcatcaccaaaggcgatctgctggaaggcattacccgcaaaggcaacatg
gccaccaccgaaactctgctgatccgcggtaaatcacgcaccattcgccgcatccgctca
acccactatttggatcgtaaagacgccgcactgcacgaatttcttctgtaa

DBGET integrated database retrieval system