KEGG   Chania multitudinisentens: Z042_11655Help
Entry
Z042_11655        CDS       T02987                                 

Definition
(GenBank) alpha-D-glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sfo  Chania multitudinisentens
Pathway
sfo00010  Glycolysis / Gluconeogenesis
sfo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Z042_11655
Enzymes [BR:sfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     Z042_11655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD SHOCT Acid_PPase PNK3P Urocanase
Motif
Other DBs
NCBI-ProteinID: AHG20211
UniProt: W0L8Z1
Position
1003114..1003704
Genome map
AA seq 196 aa AA seqDB search
MLYIFDLGNVIVDIDFKRVLGVWSNLSGTPLAMLTDRFSMGEVFQQHERGEISDEDFAAK
LCDEMGIALSFEQFATGWQAVFVALRPEVIDIMHRLRSEGHRVVVLSNTNRLHCNYWPQH
YPQVAEAADHMYLSQDIGMRKPDANIYQHVLTAENTPADQAVFFDDVAVNVAAAEALGIK
AVQVTDRQVIPAYFAQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatctttgatttaggtaatgtgatcgtcgatatcgattttaaacgtgtgctg
ggagtatggagtaatctgagcggtacaccgctggcgatgttgaccgatcgtttcagcatg
ggtgaggtcttccagcagcacgaacgcggtgaaatcagcgacgaagattttgcggccaaa
ctgtgtgatgaaatggggattgcgcttagtttcgaacagtttgccactggctggcaggcg
gtgtttgtcgcactgcgcccggaagtgatcgatatcatgcatcgcctgcgcagcgaaggg
catcgcgttgtggtgttgtcgaataccaaccgtttacactgcaactactggccacagcat
tacccgcaagttgccgaagccgccgatcatatgtatctgtcgcaggatatcggtatgcgt
aaacccgatgccaatatttatcagcatgtactgacagcagaaaataccccggcggatcag
gccgtgtttttcgatgatgttgccgttaacgtggcagcggcagaggcgctgggtattaaa
gcggtgcaggttaccgatcggcaggttattccggcttatttcgctcaatga

DBGET integrated database retrieval system