KEGG   Chania multitudinisentens: Z042_13150Help
Entry
Z042_13150        CDS       T02987                                 

Definition
(GenBank) membrane protein
  KO
K08993  putative membrane protein
Organism
sfo  Chania multitudinisentens
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Z042_13150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1145
Motif
Other DBs
NCBI-ProteinID: AHG20469
UniProt: W0LDK6
Position
663634..663906
Genome map
AA seq 90 aa AA seqDB search
MLINLGRLLMVCVWAFLLTNLFSPFPKPLKYFIDVALFFMVVMHGLQLVLLKSTQPKDQP
IGRWQETKIFIFGVFELLAWQKKQPPLKKK
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgctgattaatctgggccgcttgctgatggtgtgcgtgtgggccttcttgctcactaat
ctgttttccccatttcctaagccactaaaatatttcatcgacgtcgcgttattctttatg
gtggtgatgcacgggttgcaactggtgttgctgaaatctacccaaccgaaagatcagccg
attggccgctggcaggaaaccaaaatctttattttcggtgtctttgagctactggcgtgg
cagaagaagcagccaccacttaagaagaaataa

DBGET integrated database retrieval system