KEGG   Chania multitudinisentens: Z042_15725Help
Entry
Z042_15725        CDS       T02987                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sfo  Chania multitudinisentens
Pathway
sfo00071  Fatty acid degradation
sfo00072  Synthesis and degradation of ketone bodies
sfo00280  Valine, leucine and isoleucine degradation
sfo00310  Lysine degradation
sfo00362  Benzoate degradation
sfo00380  Tryptophan metabolism
sfo00620  Pyruvate metabolism
sfo00630  Glyoxylate and dicarboxylate metabolism
sfo00640  Propanoate metabolism
sfo00650  Butanoate metabolism
sfo00900  Terpenoid backbone biosynthesis
sfo01100  Metabolic pathways
sfo01110  Biosynthesis of secondary metabolites
sfo01120  Microbial metabolism in diverse environments
sfo01130  Biosynthesis of antibiotics
sfo01200  Carbon metabolism
sfo01212  Fatty acid metabolism
sfo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Z042_15725
   00630 Glyoxylate and dicarboxylate metabolism
    Z042_15725
   00640 Propanoate metabolism
    Z042_15725
   00650 Butanoate metabolism
    Z042_15725
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Z042_15725
   00072 Synthesis and degradation of ketone bodies
    Z042_15725
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Z042_15725
   00310 Lysine degradation
    Z042_15725
   00380 Tryptophan metabolism
    Z042_15725
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Z042_15725
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Z042_15725
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Z042_15725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfo04147]
    Z042_15725
Enzymes [BR:sfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Z042_15725
Exosome [BR:sfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Z042_15725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHG20889
UniProt: W0LET8
Position
complement(113326..114501)
Genome map
AA seq 391 aa AA seqDB search
MEDIVIVGAKRTAIGSFQGGLSTVPATELGTAVIKDLLQTYNLKPENVDQVIMGQVLTAG
CGQNPARQAALNAGLPNNVCALTINKVCGSGMIAIQLAIQAIRHGDAEVIIAGGQENMSL
SPHILLSSRQGVRVGNSNIVDSMVNDGLTDAYNGYHMGITAENVADQYSISREEQDAYSI
RSHQKALAAIEEGKFKAEISPVTVIHKKGSQVIDTDEGPRVTEAARLAKLKPAFHSQGTV
TAGNASSLNDGAAAVIVCSASKAKELGLTPLVKISAFANTGICPSIMGVAPISAITQCLE
KINKEISQIDLFECNEAFAAQALAIKRTLAIPKEKININGGAIALGHPIGASGCRILVSL
IHQLSARNLKNGIAALCVGGGEGLAMAVARV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggaagatattgttattgtaggtgccaagagaacggccatcggttcatttcaggggggg
ttatccactgtccctgctaccgaattaggcacggctgttataaaagatttattacagaca
tataatcttaagcctgaaaatgttgaccaggttattatggggcaggtgttaacggcgggg
tgtggtcaaaatcctgcacgtcaggccgcattaaatgctgggttgccaaataatgtctgt
gcgctaacgatcaataaagtttgtggttctgggatgatcgcaatccagttagctattcag
gctattcgtcatggcgatgctgaagtgattattgccggtgggcaagagaatatgtctcta
tcccctcatatcctcttgtcttcacgtcagggtgtgcgtgtcgggaatagtaacattgtt
gattcgatggttaatgatgggctaacggatgcctataatggttaccatatggggatcact
gcggagaatgttgctgaccaatatagtatttcacgtgaggagcaagatgcgtactcaata
cgctcccatcaaaaagcgttagcagcgatagaagaagggaaatttaaagcggagatctca
ccggttaccgtcatccataaaaaaggctcgcaggttattgatactgatgaagggccaaga
gtcactgaggctgccaggctggcgaagttaaagcctgcgtttcattctcagggtacggta
acggctggcaatgcttcgtcattgaatgatggggcggcagcagtcattgtttgtagcgca
agtaaagctaaagagctggggttgacgccgctggttaaaatttctgcttttgccaatacc
ggcatttgcccctcaataatgggtgttgctccgatttcggcaattactcagtgcttggag
aagatcaataaagagatttcgcagatagatctttttgagtgcaatgaagcttttgctgca
caggcattagccattaaaagaacgttagcgatcccgaaagagaaaattaacattaatggt
ggtgcaattgccttagggcaccctattggagcttcaggctgccgtattttggtttcactt
attcatcaactgagtgctcggaacctcaaaaatggaatcgcagcattgtgtgttggaggc
ggtgagggtcttgcaatggcggtggcacgggtatag

DBGET integrated database retrieval system