KEGG   Chania multitudinisentens: Z042_16015Help
Entry
Z042_16015        CDS       T02987                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
sfo  Chania multitudinisentens
Pathway
sfo00511  Other glycan degradation
sfo00520  Amino sugar and nucleotide sugar metabolism
sfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Z042_16015
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Z042_16015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sfo03110]
    Z042_16015
Enzymes [BR:sfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Z042_16015
Chaperones and folding catalysts [BR:sfo03110]
 Intramolecular chaperones
  Others
   Z042_16015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Glycohydro_20b2
Motif
Other DBs
NCBI-ProteinID: AHG20940
UniProt: W0LG71
Position
complement(34482..36875)
Genome map
AA seq 797 aa AA seqDB search
MQRSIRYTLLASSLLLAFPALAQPAGDLPLMPWPQQVELAQPQGKLVLDYRLAIAIQGDD
LAGALPGWRERIERQTGWTLAPQGAKNATATIDIIIKQQVAAQPLPDSDESYQLKVTPQG
VTLAANTRFGALRGMETLLQLVQTDGENTFIPLVNITDVPRFPWRGVLLDSARHFLPVQD
ILRQLDGMAAAKLNVLHWHLTDDQGWRFASEHYPKLQQLASDGHFYTREQMEQVVAYATA
RGIRVVPEIDLPGHASTIAVAYPDLMSAAGPYQMERAWGVHKPTLDPANDKVYQFVDSII
GELAAIFPDPYLHIGGDEVDATQWKESKTIQAFMQQNQLADTHALQAFFNQKLEKILEKH
QRRMVGWDEIYHPALPHNIVIQSWQGPDALGASAQDGYQGILSTGFYLDQPHRAAFHYRN
EVLPQPLGVVTEVRAGESAQSWQFSMPRLKGSAVEGTFTLIEGKEGWRGFIDFKGKSRRA
VQEIEWRTPEQVTFRIDSWMGETRPVLTLQQEQLSGYILVGNVRYPATGSKLAAIPAGKM
PVVPGAQQQANILGGEAALWAENIRAPIIDLKLWPRAFAVAERLWSAKDVTDENNMYQRL
AAVDAWSVVSVGLQQHMETAREFTRLANSVDITPLQVLAEAVEPGQYYTRHHLKFQAGNY
HQFEPLNRFADALPAESAAVRDLHAQVALLLQDKNHLAAAQAIRERLQHWQRNGAPVQKV
IAGNVVMKDLAPVAQDVSSLADLGLMLLERYQQGKPLSEAEAEQAQQQLDAATQIRDEVV
IAAVYPLETLLRGITVQ
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgcagagatccatccgttatacgctactggcttcttcgttgttacttgcttttccggca
ctggcccagcccgcgggtgatttaccgctgatgccttggccgcagcaggttgaactggcg
cagccgcaaggcaaactggtgctggattaccgcctggcgattgccattcagggggatgat
ttggcgggcgctttgcccggctggcgtgagcgtatcgagcgccaaaccggttggactttg
gcaccgcagggcgcgaaaaatgcgacggccaccattgatatcatcatcaaacagcaggtg
gcggcgcagcctttgccggatagcgatgaaagctatcaattgaaagtgactccacagggg
gtaaccctggcggccaacacccgttttggggcgttacgcggtatggaaacgctgttgcaa
ctggtgcagaccgacggtgagaacacctttatcccgctggtgaatattacggatgtgcca
cgtttcccctggcgcggcgtgctgctggattcggcgcgccacttcctgccggtgcaggac
attctgcgccagctcgacggcatggcggcggccaagctcaacgtactgcactggcacctg
accgacgatcagggctggcgtttcgcctctgagcattacccgaagctgcaacagttggcc
agtgacggccatttttacacccgtgagcagatggaacaggtagtggcgtatgccactgcg
cgcggcatccgcgtagtaccggaaattgatctgccgggccatgcttcgactatcgccgtg
gcttatcccgatctgatgagcgcagcggggccgtatcagatggagcgggcatggggggtt
cataaaccgacgctcgatcctgccaatgacaaggtgtatcagtttgtcgacagcatcatc
ggtgaactggccgcgatcttccccgatccttatctgcatattggcggagatgaagtggat
gccacgcagtggaaggaatcgaaaacgattcaggcatttatgcagcaaaaccagttggcg
gatacccatgcgctgcaagccttcttcaaccagaagctggaaaagatcctcgaaaaacat
cagcgccgcatggtgggctgggatgagatttatcatcctgccctgccgcataacattgtg
atccaatcctggcaggggccggatgctttgggagccagcgcgcaggatggctatcagggc
attctgtccactggtttttatctcgatcagccgcaccgagcggctttccactaccgcaat
gaagttctgccgcagccgctgggcgtggtgacggaggtgcgggcaggggaaagcgcacaa
agctggcagttcagtatgccacgcctgaaaggcagcgcggttgaaggcacgttcacgctg
attgaaggcaaagagggctggcgcggctttattgatttcaaggggaaatcacgccgtgcg
gtgcaagagattgaatggcgcacgccagaacaggtgaccttccggatcgacagttggatg
ggggaaacgcgcccggtactgacgctgcaacaggagcaattgagcggttatatcctggtg
ggcaacgtgcgttacccggccacgggcagcaaactggcggcgatcccggcaggcaaaatg
ccggtggtgccgggcgcgcagcagcaagccaatatcctgggcggggaagcggcgctgtgg
gcggaaaatatccgtgcgccgatcatcgatctcaaactgtggccacgtgcctttgcggtt
gcagaacgcttgtggtcggccaaagatgtcaccgatgaaaacaacatgtatcagcgcttg
gcggcggtggacgcctggtcggtggtgtctgtcgggttgcagcagcatatggaaaccgca
cgtgagttcacccgtttggccaacagcgtggatatcacgccgttgcaggtgctcgccgaa
gccgtggaaccagggcagtattacactcggcatcatttgaagttccaggccggaaattat
catcagtttgagccgctcaaccgctttgccgacgctctgccagcagaaagcgcggcggta
cgcgatttgcacgctcaggttgcgttgctgctgcaagacaagaaccacttggccgcagca
caggcgattcgtgagcgtttacagcattggcaacgcaatggcgcaccggtgcagaaagtg
attgcgggcaacgtggtgatgaaggatctggcgccggtggcgcaggatgtcagcagcttg
gccgatctggggttgatgctgttggaacgttatcagcaaggtaaaccattgagcgaagcc
gaagcggaacaggcccagcaacagttggatgccgccacgcagatccgtgacgaagtggtg
attgcagcggtgtacccgctggaaacccttttgcgcgggattacggtgcagtaa

DBGET integrated database retrieval system