KEGG   Staphylococcus felis: C7J90_05885Help
Entry
C7J90_05885       CDS       T05459                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sfq  Staphylococcus felis
Pathway
sfq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sfq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C7J90_05885
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sfq03011]
    C7J90_05885
Ribosome [BR:sfq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C7J90_05885
  Bacteria
    C7J90_05885
  Archaea
    C7J90_05885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 BAT
Motif
Other DBs
NCBI-ProteinID: AVP36499
UniProt: A0A2K3ZGJ9
Position
1281209..1281562
Genome map
AA seq 117 aa AA seqDB search
MEAKAVARTIRIAPRKVRLVLDLIRGKDVREAVAILKVTDKASSPVIEKLLMSALANAEH
NYGMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAQEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgctagaactatcagaatcgcacctcgtaaagtaagattagtc
ttagacttaatcagaggtaaagatgtaagagaagcagtagctatcttaaaagtaacagat
aaagcatcttctccagtcattgaaaaattattaatgtccgctttagctaatgcagaacat
aactatggtatgaatactgacgaattagttgtgaaagaagcatatgctaacgaaggacca
acattaaaacgtttccgtccacgtgctcaaggacgcgcaagcgcaattaataaaagaaca
agccacattacaattgttgtaagtgatggtaaagaagaagctcaagaagcttaa

DBGET integrated database retrieval system