KEGG   Staphylococcus felis: C7J90_06380Help
Entry
C7J90_06380       CDS       T05459                                 

Definition
(GenBank) sirohydrochlorin chelatase
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
sfq  Staphylococcus felis
Pathway
sfq00860  Porphyrin and chlorophyll metabolism
sfq01100  Metabolic pathways
sfq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C7J90_06380
Enzymes [BR:sfq01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     C7J90_06380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiX CbiK Ferrochelatase
Motif
Other DBs
NCBI-ProteinID: AVP36590
UniProt: A0A2K3ZFM8
Position
1363473..1364255
Genome map
AA seq 260 aa AA seqDB search
MKGVLYVSHGTRLKQGVKEAHNLIDKVKQHIPIPFQETCFLEITSPNIENGFKRLIHKGV
NHVIVIPVLLLSAGHFYHDIPKAIHQLKKRFAHITITLGRPLGVQYRLVEILKERIEAIS
VSNPESAQFILVGRGSNYEETKQDMNEIKSMLKSLMGMSNVNVCYLAATEPKFEHILKQA
IHEKHQEIIVIPYLWFSGLLTHYIHKTLHDTGYKGTLKRCHHLGDHPNMIDALRDRVLET
IQKAEKEKQSRKDKHHVIVT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggggtactttatgttagtcatggaacaaggttaaaacaaggtgttaaagaagct
cacaacttgatagataaagtgaaacaacatatcccgataccattccaagaaacatgcttt
ctagagataacgagtcctaatattgaaaatggatttaaaagattaattcataagggtgtt
aatcatgtcatcgtgatacccgtattattactatcggcggggcatttttatcatgatata
cctaaagccattcatcagctcaaaaaacgctttgcacatatcacaattactttgggacgg
ccactaggcgttcaatatcgattagttgaaattttaaaagaaagaatcgaagcgatatct
gtgtctaatcctgaaagtgctcagttcatacttgtaggaaggggaagcaattatgaagaa
acaaaacaagatatgaatgagatcaagtcgatgctcaaaagtttaatgggaatgtcgaat
gttaacgtttgttatttagcagcaactgaacctaaatttgaacatatccttaaacaagct
attcatgaaaagcatcaagaaattatagtcataccttatctttggttctcaggactactt
acacattacattcacaagacacttcatgatacgggctataaaggaactttaaaacgatgc
catcatctaggagatcatccaaatatgatagatgctctaagagatcgtgtattagagact
attcaaaaagctgaaaaagaaaaacaaagtcgaaaggataagcatcatgtcattgtcact
taa

DBGET integrated database retrieval system