KEGG   Staphylococcus felis: C7J90_11440Help
Entry
C7J90_11440       CDS       T05459                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sfq  Staphylococcus felis
Pathway
sfq00970  Aminoacyl-tRNA biosynthesis
sfq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C7J90_11440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sfq03029]
    C7J90_11440
Enzymes [BR:sfq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     C7J90_11440
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     C7J90_11440
Mitochondrial biogenesis [BR:sfq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    C7J90_11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey GFP
Motif
Other DBs
NCBI-ProteinID: AVP37516
UniProt: A0A2K3ZIJ8
Position
complement(2393564..2394991)
Genome map
AA seq 475 aa AA seqDB search
MHFETIIGLEVHVELKTDSKMFSNAPVGYGAEPNTNTSVIDLAYPGVLPTVNRRAVDWSM
RAAMALNMDIATESKFDRKNYFYPDNPKAYQISQLDQPIGEHGHIDIEVNGETKRIGITR
LHMEEDAGKSTHKNGYSLVDLNRQGTPLVEIVSEPDIRSPEEAYAYLEKLKAIIQYTGVS
DCKMEEGSLRCDANVSLRPYGQKEFGTKAELKNLNSFNNVRKGLEYEVKRQEEELLNGGE
ILQETRRFDEATGKTILMRVKEASDDYRYFPEPDIVPLYIDEAWKERVRQTIPELPDARK
AKYVSEYGLPEYDAHVLTLTKEMSDFFEGAVKEGADIKLTSNWLMGGVNEYLNKNQIELK
DTALTPENLAGMIKLIEDGTMSSKIAKKVFPELAQNGGNAQQIMKDKGLVQISDKGAVLK
FVQEAIENNPQSVEDYQNGKGKAMGFLVGQIMKLSKGQANPQLANQLLKEELDKL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcattttgaaacaataatagggcttgaagtccacgttgaattgaaaacagattctaaa
atgttttcaaatgcacctgttggatatggtgcagaacctaatacaaacacaagcgtaatc
gatttagcttatccaggtgtcttacctactgttaatagacgcgcagtagattggtctatg
cgtgctgctatggcgcttaatatggatattgcaacagagtctaaatttgatcgaaaaaat
tatttttatccagataatccaaaagcataccaaatttcacaattagaccaacctattggt
gaacacggtcatattgatattgaagtgaacggtgaaacaaaacgcatcggcattacacgt
cttcatatggaagaagatgctggtaaatctacgcacaaaaatggttattcattagtggac
ttaaatcgtcaagggacgccattagttgaaatcgtttcagaacctgatattcgctcacca
gaagaagcttatgcttatttagaaaaattaaaagcaattattcaatatactggtgtatcg
gattgtaagatggaagaaggttctttacgttgtgatgccaatgtttcattacgtccttat
ggccaaaaagaatttggaactaaagcagaacttaaaaacttaaactcatttaataacgtt
cgaaaaggacttgaatatgaagttaaaagacaagaagaagagttattaaatggtggagag
attctacaagaaacacgtcgttttgatgaggcaacaggtaagactatcttaatgcgtgtg
aaagaagcttcagatgattatcgttacttccctgagccggacatcgtacctttatacatt
gatgaagcatggaaagaacgcgtacgtcaaacgattccagaattacctgacgcacgaaaa
gcaaaatatgtatctgaatatggtttgcctgaatatgatgcacacgttttaactttaaca
aaagaaatgtctgatttctttgaaggtgctgtaaaagaaggtgcagatattaaattaaca
tctaactggttaatgggtggcgttaatgaatatttgaataaaaaccaaatcgaattgaaa
gatacagcattaacacctgaaaacttagcaggaatgattaaactgattgaagatggaaca
atgagcagtaaaattgctaaaaaagtattcccagaacttgctcaaaatggtgggaatgca
caacaaattatgaaagataaaggtttagttcaaatttctgataaaggtgcagtcctaaaa
ttcgtccaagaagcgattgaaaataatccgcaatctgttgaagactatcaaaatggtaaa
ggcaaagcgatgggcttcttagttggacaaattatgaaactttcaaaaggacaagcaaac
ccacaacttgctaatcaattattaaaagaagaacttgataagttataa

DBGET integrated database retrieval system