KEGG   Staphylococcus felis: C7J90_11445Help
Entry
C7J90_11445       CDS       T05459                                 

Gene name
gatA
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sfq  Staphylococcus felis
Pathway
sfq00970  Aminoacyl-tRNA biosynthesis
sfq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C7J90_11445 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sfq03029]
    C7J90_11445 (gatA)
Enzymes [BR:sfq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     C7J90_11445 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     C7J90_11445 (gatA)
Mitochondrial biogenesis [BR:sfq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    C7J90_11445 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AVP37517
UniProt: A0A2K3ZII0
Position
complement(2395005..2396465)
Genome map
AA seq 486 aa AA seqDB search
MSIRYESIENLQKMIKNNEIKPSEIVKDIYNAIEETDPTIQSFLALDKDNAIKKAEALDA
LQEKGQIEGKLFGIPMGIKDNIITEGLETTCASKMLEGFVPIYESTVMKKLHAENGILIG
KVNLDEFAMGGSTETSYFKKTVNPFDHKAVPGGSSGGSAAAVAAGLVPFTLGTDTGGSIR
QPAAYCGVVGLKPTYGRVSRFGLVAFASSLDQIGPITRNVKDNALVLEAISGEDEMDSTS
APGVATDFTSEIGNDIQGMKIALPKEYIGEGVDEEVKSAVLEAAETLKTLGATVEEVSLP
RTSAGIPSYYVIASAEASSNLARFDGIRYGYHSKDAKSLEELYKMSRSEGFGDEVKRRIF
LGTYVLSSGYFDAYYKKAQKVRTLIKNDFEKVFEDYDVIIGPTTPTVAFDLGSEINDPLT
MYANDLLTTPVNLAGLPGISLPCGLAENKRPIGLQLIGKPFDEKTLYRVAYQYETKFNLH
DQYQNL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagcatccgttatgaatcaattgaaaatctacaaaaaatgataaaaaataatgaaatt
aaaccttcagaaattgtaaaagatatttataatgctattgaagaaacggatccaactatt
caatcatttctcgcattagataaagacaatgcaatcaaaaaagcagaagcgcttgatgca
ttacaagagaaaggtcagattgaaggaaaattattcgggattcctatggggattaaagat
aacattattacagaaggtttagaaacaacatgtgcaagtaaaatgctagaaggctttgta
cctatttatgaatcaactgtaatgaaaaaattacatgctgaaaatggtattcttattggt
aaagtaaacttagatgagtttgcaatgggtggttctactgaaacatcttactttaagaaa
acagttaacccatttgatcacaaggctgtaccaggtggatcatcaggtggttcagcagca
gcagtggctgcaggtctcgtgccatttacattaggtactgatacgggtggttcgattcgt
caaccggcagcgtattgtggcgtagttggattaaaacctacatatggacgtgtttctcgt
tttggattagttgcgtttgcatcttctttagatcagattggtcctattacacgtaatgta
aaagacaatgcacttgttcttgaagctatttctggtgaagatgaaatggactcaactagt
gcaccaggtgttgcaacagacttcacttcagaaattggaaacgatattcaaggtatgaaa
attgccttacctaaagaatatattggtgagggtgtcgacgaagaagtgaaatcagctgta
ttagaagcggctgaaactttaaaaactctaggagcaacagttgaagaagtgagtctcccg
cgtacatcagctggtattccgtcatattatgttattgcgtcagcagaagcgtcttcaaac
ttagcgcgttttgatgggattcgttatggttaccattctaaagatgcaaaatcgcttgaa
gaattatataaaatgtcacgtagcgaaggatttggagacgaagttaaacgccgtattttc
ttaggaacatatgtattgagttcgggttactttgatgcctactataaaaaagcgcaaaaa
gttcgtacgttaatcaaaaatgattttgagaaagtttttgaagactatgatgttattatt
ggaccaacgacaccgactgtagcatttgatcttggaagtgagattaatgatccattaaca
atgtatgccaatgatttgttaacaacacctgttaacttagcaggtttacctggtatctca
ttgccatgtggtttggcagaaaacaaacgtccaatagggcttcaacttatcggtaaacca
tttgatgaaaagacattatatcgcgtagcatatcaatacgaaacaaagttcaacctacac
gatcaatatcaaaacttataa

DBGET integrated database retrieval system