KEGG   Shewanella frigidimarina: Sfri_0039Help
Entry
Sfri_0039         CDS       T00395                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sfri_0039
Enzymes [BR:sfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sfri_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Abhydrolase_5 LIDHydrolase Ser_hydrolase DUF900 PGAP1 LCAT Esterase
Motif
Other DBs
NCBI-ProteinID: ABI69902
UniProt: Q08A13
Position
complement(50300..51274)
Genome map
AA seq 324 aa AA seqDB search
MHYMKFSSELKLDTSEQRHFWQQVHQSSFCTDDGINIAYAMIQHPNSQRAIVISNGRVES
YIKYQELMFDLYQQGFSVYALDHRGQGLSDRLTHNPHQGYVASFTDYTEDLTQFINQIVS
QQQHDELFIIAHSMGCTIASDYINQHPNTFTAAVFSAPMFGIRLPFTKPIIRWLAQKLDN
NRLEANKVHSTFVIGGTHYKPDSFKRNRLTHSQKRYKHYRNIFEETTKAQLGSPTNHWLL
EAMDAAEKCIDYAKHSQTPILILQAEKDTIVCNEAQNQALSTHCHKVIIEGAYHEVFIEK
DTMRNIALSHTIDFMAQHSKIAVS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcattacatgaaattttcatctgaattaaagctcgatactagtgagcaaagacacttt
tggcaacaagtacaccaatcgagtttttgtactgatgacggtataaatattgcctatgcg
atgatccaacatcctaatagtcaacgagcaatagtgatcagcaatggcagagtagaatct
tatataaaatatcaagaattgatgtttgatttatatcaacaaggatttagcgtttacgct
ttagatcatcgaggacaaggattatcagaccggctcacacataatccgcatcaaggttat
gttgctagctttactgattataccgaagacttaactcaatttattaatcagatagttagc
caacaacagcatgatgagctatttatcatcgctcactcaatgggatgcaccattgccagc
gattatattaatcaacacccaaatacatttactgcagccgtattctcagcgcccatgttt
ggtattcgattaccgtttacaaaacctatcattcgttggctagcacaaaagctcgataat
aatcgtctggaagcaaataaagtacacagcacatttgtaatagggggaacccattacaaa
cccgacagctttaaacgcaaccgactgactcatagccaaaaacgttataagcactatcgc
aacatcttcgaagaaaccactaaagcacagttaggctcaccgactaaccattggttacta
gaggcaatggatgcagcggagaaatgcatcgactacgctaaacacagccaaactccgata
ctaattttgcaagctgaaaaagacacgattgtctgtaatgaggcgcaaaaccaagcacta
agcactcattgtcataaagtgatcattgaaggcgcatatcacgaagtattcatcgagaaa
gatactatgcgtaatatcgccctgtctcataccattgactttatggcacaacactcaaag
atagctgtgtcttaa

DBGET integrated database retrieval system