KEGG   Shewanella frigidimarina: Sfri_0439Help
Entry
Sfri_0439         CDS       T00395                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00860  Porphyrin and chlorophyll metabolism
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01120  Microbial metabolism in diverse environments
Module
sfr_M00121  Heme biosynthesis, glutamate => heme
sfr_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sfri_0439
Enzymes [BR:sfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sfri_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Homeobox YdaS_antitoxin
Motif
Other DBs
NCBI-ProteinID: ABI70301
UniProt: Q088L4
Position
complement(503525..504244)
Genome map
AA seq 239 aa AA seqDB search
MKVLLTRPQGRNQAMEEQLSLRDVAYLVTPLLSVVETTEQLNPTHLNNTDNLLFISSNAV
DFAAQKLQQQFPTHCRYFAVGQATADSLAQYNINAFTSPEHSQDSEGLLSLAQLQDVDKQ
SFIIVRGLGGRETLAEQLQLRGANVNYWQVYQRAIPNLDGKAITQQWKSFGIDTIVVTSG
EILSNLVELVPKELFAWLRACHIIVPSNRVELQAKAMGLSHISNANGANTQAILASLAL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcttgttaacgcgcccacaagggcgcaatcaagcaatggaagagcaactctcg
ctgcgagacgttgcttatcttgttactccgctattatcggttgtagaaaccacagaacaa
ctcaatcctacccacttaaataacactgacaacttactgtttattagtagcaatgcagtg
gactttgccgcacaaaaactgcaacagcaatttccgactcactgtcgttattttgctgta
ggccaagctacggcagatagtctagctcaatataatatcaatgcttttacctcaccagaa
cacagtcaagatagcgaaggattattgtcgctagcccaattacaagatgtcgataaacag
tcatttattattgttcggggtttaggcggacgagaaacacttgcagagcaattacagctg
cgaggcgccaatgtgaactattggcaagtctaccaacgagcaataccaaaccttgacggt
aaagcgataactcaacagtggaaatcgtttggaattgacaccattgtcgtcaccagcggt
gaaatattatccaacttagttgagcttgtaccaaaagaattatttgcatggctacgtgca
tgtcatatcatagtccccagtaatcgcgtcgaattacaagcaaaagcaatgggcttaagc
catatctccaatgcaaatggagcaaatactcaagctatactagcgagtcttgcgttataa

DBGET integrated database retrieval system