KEGG   Shewanella frigidimarina: Sfri_1262Help
Entry
Sfri_1262         CDS       T00395                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
sfr  Shewanella frigidimarina
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sfr03016]
    Sfri_1262
Enzymes [BR:sfr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     Sfri_1262
Transfer RNA biogenesis [BR:sfr03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    Sfri_1262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ABI71115
UniProt: Q085F0
Position
1493272..1494153
Genome map
AA seq 293 aa AA seqDB search
MISKENDAEYSLDNDDLYEQIGSEYIDENATADTELDDDLHPPHIDILFEDEHLVAIHKP
AGLLVHRSYLARRERFFAMQMTRDLVGCHVFPVHRLDRPTSGVLLFAKSSEVARALCEQF
ADHSIKKHYLAIVRGNMHESGTLDYALKQEFDDLGDKHVDQNKAAQDAVTDYQPLLNTEI
PFSSGRYPTSRYGLVKLSPHTGRKHQLRRHMAHLRHPIVGDTTHGDGKQNKFFREHFTIN
RLWLIAKSLQFVHPVTQQSMHIETELEAEWLTVFNAFGWDDDQLSSMPSMLLS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgatctcaaaagaaaacgatgctgaatactcattagataacgatgacttatatgaacaa
ataggctcggaatatattgatgagaacgctactgcagataccgaattagacgatgactta
caccctccccatatcgacattctatttgaagatgagcacctagttgctatccataagcct
gcaggtttattggttcatcgtagttatttagcccgtagggagcgattttttgcgatgcag
atgactcgtgatttagtgggctgccatgtttttccggtgcaccgcctagatagacctaca
tctggagtattactgtttgccaaatcgagtgaggtggctcgtgcattatgtgagcaattt
gctgatcatagtattaagaagcattatttagccattgttcgtggcaatatgcatgagtct
ggcacgctagattatgccctaaaacaggagtttgatgatttaggcgataaacatgtggac
cagaacaaggctgctcaagatgccgtgacggattatcaaccattattgaatacggaaata
ccgtttagttcaggtcgatacccaactagtcgttatggcttggtaaaattaagccctcat
actggccgcaagcaccaattacgtcgtcatatggcacatttacgtcatccaattgttggt
gatacaacccatggcgatggtaaacaaaataagttctttcgcgaacattttactattaac
cgtttgtggttgattgcaaaaagcttgcagtttgtacacccagtaactcagcaatcaatg
catattgaaactgagttagaagctgaatggttgactgtttttaacgcatttggctgggat
gatgatcaattatcatcaatgccaagtatgttattaagttaa

DBGET integrated database retrieval system