KEGG   Shewanella frigidimarina: Sfri_1426Help
Entry
Sfri_1426         CDS       T00395                                 

Definition
(GenBank) phosphoribosylanthranilate isomerase / indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01130  Biosynthesis of antibiotics
sfr01230  Biosynthesis of amino acids
Module
sfr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sfri_1426
Enzymes [BR:sfr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sfri_1426
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Sfri_1426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI Transferase
Motif
Other DBs
NCBI-ProteinID: ABI71278
UniProt: Q084N7
Position
complement(1699995..1701398)
Genome map
AA seq 467 aa AA seqDB search
MSKPESNVLTRIVDTKVAHIAALKLRFPEANLQPKISDRSLYDAMKAPNAQFIFECKKAS
PSKGLIRPVFDVEAIADIYVHYAAGISVLTDEQFFQGDMDYIPKVRARVTQPIICKDFFV
DPYQVKLAAHQGADAILLMLSVLDDEQYRLLANEAAKYQLDTLTEVSNQAELIRAIDLLA
PIIGINNRNLRDLSTDLATTELLAPQIPADRVVISESGIYNHQQVCRLNPLVDGYLVGSS
IMAQDDIDLACRQLIFGNNKVCGLTRIDDIEAVATAGAVFGGLIFHPKSPRAVTPAQASE
LIAQMQQRNIGLNMVGVFVNHPVADIASLAQTLNLFAVQLHGNETELEITELKALLKQQQ
LNTEIWKAVAINSNNGEVSQKPAGADRYLYDSKSAHQFGGTGQTFNWQADIDDKQDAMLA
GGLTPDNVYLASQQGFYGVDLNSGVESTPGHKDHQKLIAAFTQLRRN
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagccagaaagtaatgtattaacccgtatcgttgatactaaagtggcccatatc
gccgcgctaaaactgcgtttccctgaagccaacctacaacctaaaatatctgaccgtagc
ttatacgatgccatgaaagcacctaatgctcagtttatttttgagtgtaaaaaggccagc
ccttctaaagggcttattcgccctgtatttgatgttgaagccatcgcagatatttatgtc
cattacgctgctggcatctctgtgctaaccgatgaacagtttttccaaggtgacatggac
tacattccaaaagtccgcgcaagggtaactcaaccgattatctgtaaggacttttttgtt
gacccgtatcaagtgaaattggcagcccatcaaggtgctgatgccattttactgatgttg
tcagtacttgatgatgagcaatatcgtttattagccaacgaagcggctaagtatcaatta
gataccttaaccgaagtcagtaaccaagcagaattgattagagcgattgatctccttgcc
ccaataattggtattaacaatcgtaatttacgcgacttaagtactgatttggcgacaact
gagttattagcaccacaaatcccagcagacagagtggtcattagtgaatcaggcatttat
aaccatcaacaagtttgccgcctaaatccattggttgacggttatcttgttggcagttca
attatggcgcaagacgatattgatttagcgtgcagacaacttatttttgggaacaataaa
gtctgcggtttgactcgaattgacgatattgaggcagtagctacagctggagcggtattt
ggagggctaatttttcatccaaaatcacctagagccgtaacacctgcacaagcaagtgaa
ttaatcgcccaaatgcagcaacgtaatattggcttaaatatggtgggtgtgtttgttaat
caccccgttgcagatatcgcttcattagcccaaacgctgaatctttttgcagtgcaatta
cacggcaatgaaactgaacttgaaatcacagaattaaaagcgttacttaagcaacaacag
ctcaataccgaaatttggaaagccgttgcaattaacagtaacaacggcgaagtgagccaa
aaacctgctggcgccgatcgttatttatacgacagcaagtcagcacatcaatttggcggc
accggacaaacgtttaattggcaagcagatattgatgataaacaagatgcgatgttggcg
ggaggattaaccccagacaatgtttatctagcaagccaacaaggattttatggggtcgac
ttaaattcaggagtagaatctacccctggccataaagaccaccaaaaactgattgctgca
tttactcaattacgccgtaattaa

DBGET integrated database retrieval system