KEGG   Shewanella frigidimarina: Sfri_1505Help
Entry
Sfri_1505         CDS       T00395                                 

Definition
(GenBank) molybdopterin oxidoreductase
  KO
K00372  assimilatory nitrate reductase catalytic subunit [EC:1.7.99.-]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00910  Nitrogen metabolism
sfr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Sfri_1505
Enzymes [BR:sfr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     Sfri_1505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4 Fer2_BFD DUF1269 Lys_export AAA_25
Motif
Other DBs
NCBI-ProteinID: ABI71356
UniProt: O33732
Position
1794291..1797107
Genome map
AA seq 938 aa AA seqDB search
MSVVQSSCAYCGVGCGVSVSSNKPNWTDVDAADLILVGDNKHPANYGHLCAKGERLLDSL
AQPNVLRYPKLRSGMPLDWDKASTLIADTFAKTIAEHGPDSVALYLSGQLLTEDYYVANK
FAKGFLKTANVDTNSRLCMSSAVSAMQRAFGEDVVPGCYDDLEQADVIVLVGANTAWTHP
VLFQRILAAIKANNAQLVVIDPLSTATAKQADLHLAIKPGADLTLFHGLLGYLADQNRVD
HAYIAAHTEGFDTVVLQAQQLSANLADLATQVGVSVTQLTQFYQLVANNKKVLTASCQGV
NQSTIGTDATNAMINCHLALGHIGQAGCGFFSLTGQPNAMGGREVGGLATQLACHMGFSQ
PEQQLLADFWKVDSIADQKGLVAVEMFDALAEGKIKAIWIMGTNPVVSLPNSEKIAQALA
DCPFVVVSEISPDSDTAKLADVLLPAQGWSEKCGTVTNSERTITRQRGFITAKGQAKPDW
WAVSQVAKKMGFDGFEFDDNASIFSEFAALSAKVKQVFPTKVFDLTGLTELSKAQYDALA
PTQWPIASATQIGQQNVRVFGLGEFATATGKAQFVTPAVVSVPQQSLPSNTLLLNTGRSR
DQWHTMTRTGHIASLRASIPEPVVHLHSSQLSALSLTEGGLVRIEAIQNQIEQYSTETAN
PDLFTHASFTMARAVVDDDIPTNMALMSMHWSAQFSLTKGVNQALDARVDPISKQPGFKC
QPVTLTPVELALQGVVFGQHYSSAHGLCWQVAQTLENGVCHHIGFTDTDDGFAYQATVHS
LKWTLTVVGQPLYIQCNMDKGLLKALKVLSHTQVNVALYQMNDFIGKPVDKQLIKQLHQQ
IKAGNSPLICACTGVTEANINDEINQQFNDQVMSDGLANISFEQALDSTQLLLGCGRQCG
SCHSEVKQCAKQSWKDALSYCESYSDIDHQPSVAEDVA
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtggtccaatcaagttgtgcttattgtggtgtcggatgcggtgttagcgtgtct
tcaaataaaccgaattggaccgatgtcgatgctgcagatttaatactagtcggtgacaac
aagcatccagctaattacggtcatttatgtgccaaaggtgaacgcttactcgacagttta
gcccaacccaatgtactgcgttaccctaaacttcgttctggtatgccacttgattgggac
aaggcgagcaccttaattgctgatacctttgcgaaaaccattgcagaacatggtccagat
tcagtcgcactgtatctttctggccaattactcactgaagattattatgttgccaacaag
tttgctaaaggctttttaaaaacggctaacgtcgatactaactcacgcttatgtatgtcg
tcagcggtgagcgcaatgcagcgtgcctttggtgaagatgtagttcctggatgttacgac
gatctagagcaagctgatgtgatagtgcttgtaggggccaataccgcttggactcatccc
gttctttttcaaagaattttagccgcaataaaagccaataatgctcagttagtggtaatc
gacccgttatcaacagccacagcaaaacaagcagacttacatttagccattaaaccgggc
gctgatttaacattatttcatggcttactcggttacctagcagatcaaaatcgtgtcgac
cacgcgtatattgccgcacatacagaaggctttgatactgtggttttgcaggcgcaacaa
ttaagtgccaatttagccgatcttgccacgcaagtcggtgtttcagtcactcagctgacg
caattctatcaacttgtagccaacaataaaaaagtacttacggcatcttgtcagggggtt
aatcagtcaaccattggcaccgatgcaaccaatgcgatgattaactgccacctcgcgtta
gggcacattggtcaagctggttgtggttttttttcgttaacagggcagcctaatgccatg
ggcggtcgtgaggttggtgggttggccactcagttagcatgccatatgggtttttcacaa
ccggagcagcagttattagctgatttttggaaagttgatagtattgcggatcaaaaagga
ttggttgcagttgagatgtttgatgcccttgccgaaggtaaaatcaaagcgatttggatt
atgggtaccaatcctgtggtgtctttacccaacagtgaaaaaatagcacaagcattagcc
gattgtccttttgtggtggtgtctgaaatcagtcctgattctgataccgccaaacttgct
gatgtattactcccagctcaaggctggtcagaaaagtgcggtaccgtcactaatagtgag
cgcactattacgcgtcaacgtggctttatcactgccaaagggcaagctaaaccagattgg
tgggccgttagccaagtagctaagaaaatgggctttgatggttttgagtttgatgacaat
gccagcatatttagcgagtttgcagccttatcggcgaaggttaaacaggtttttccaact
aaggtgtttgatctcactgggctaacagagttatccaaagcgcaatatgatgcactagca
ccgacgcaatggcctattgcttcggcaactcaaattggtcaacaaaacgtgcgtgttttc
ggcctaggtgaatttgctaccgcgacgggtaaagcgcagtttgttacgcctgcggttgtt
agtgttccgcaacaatcattaccgagtaacaccttgttattaaacactggccgaagccga
gatcagtggcataccatgactcgcaccggacatattgctagcttacgagccagtattcct
gagcctgtcgttcacctgcattcatcacaactcagtgcattgtcgttaacagaaggtggc
ttggtccgcattgaagctattcaaaatcaaattgaacaatactccacagagaccgctaac
cccgacctttttacccacgcctcattcacgatggctcgcgctgttgtcgatgatgacata
ccgacaaatatggctttgatgtcaatgcattggtctgcacagttttcgctgacaaaaggc
gtgaatcaagcattagatgcacgtgtcgacccaatatcaaaacaacctgggtttaagtgt
caacccgtgacattaacccctgttgaacttgcgctgcaaggggtggtttttggtcaacac
tactcttctgctcacgggctatgttggcaagttgcacaaacgctagagaacggagtgtgt
catcacatcggttttactgataccgacgacggctttgcgtatcaagcgactgtgcattca
cttaagtggactttaacggtagttggccagcctttatatatccaatgtaatatggataaa
ggattacttaaggcattaaaagtattgtctcatactcaagtgaatgtggccctatatcag
atgaatgattttattggtaagcctgtcgataaacagttaattaaacagctacatcagcaa
ataaaagccggaaatagtccgttaatctgcgcttgtacaggggtaaccgaagcgaacatt
aacgacgaaatcaatcaacaatttaacgaccaagtgatgagtgacggtttagcgaatatc
agttttgagcaggcgttagatagcacccagttattactcggttgcggccgtcaatgtggc
agttgtcatagtgaagttaagcagtgtgccaagcagagttggaaagatgccttatcttat
tgcgaatcttattccgacattgaccatcaaccatcagtagcagaggacgtagcctaa

DBGET integrated database retrieval system