KEGG   Shewanella frigidimarina: Sfri_1901
Entry
Sfri_1901         CDS       T00395                                 

Definition
(GenBank) putative nucleoside transport protein
Organism
sfr  Shewanella frigidimarina
SSDB
Motif
Pfam: DUF1328
Other DBs
NCBI-ProteinID: ABI71747
UniProt: Q082R8
Position
2250689..2252425
AA seq 578 aa
MTISQHEASFKQTNEEQLPVAKNKLHGWKHFAGLYAGEHVAATEFVIGATFVALGASTID
ILLGLLIGNLLAMCSWWLLTAPIAVETRLSLYNYLNKIAGDSMTKLYNWANVIIFSVISA
AMITVSSTAVRFLFDIPAQLNWYPSSLWFVMIVLAVGSIVVVVAMYGFSTVADFSKICAP
WLFVIFIAGSFTLFPVLSNHVIGSTTLTGWQDFMTIGDSSIWTGLNDKGEPGIGLLEVIG
FAWAANSITHFGLIDMAIFRFAKRKSYGLISGVGMFFGHYLAWISAGIMGAGTAVLLKTT
ITQLDPGDVAYHALGFSGFVIIIIAGWTTANANLYRAGLAAQSIFVNHSRERTTAIVGLV
TVVIACFPFVFSQMLPLLTYAGLLVVPVGGIVFAEHVLFPKIGLTRYWAKYQKLSKSTPA
IASWALALVFGFGLNSLDIISFYYLFIPTWIFTIIIYTVLAKKYGADLDYTGAILLDEKE
QQQITEYQDEMAKDDKPHVEDGSKLTKLLNSFAVISLMVISILAAKVMFYSPTMTIYAEN
KSLFETVCFVCTIIYFSCSYIALKLRDPHEFNSMLVGP
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgacaataagtcaacatgaggcttcattcaaacaaacgaatgaagagcagctgcctgta
gctaaaaataaattacatggttggaaacactttgcaggtttatatgctggggagcatgtt
gccgcgacagagttcgttattggtgccacttttgttgctctaggtgcctcaaccattgat
atattacttggactattaattggtaatctattggcgatgtgttcgtggtggttattaacg
gcaccgattgctgttgaaactcgactcagtttatataactatttaaataagattgctggc
gactcgatgaccaagctctataactgggctaatgtgattatcttctcggtgatatccgca
gcgatgatcacagtatcgtccacagccgttcgtttcttattcgacattccggcacaatta
aattggtatcccagtagtctatggtttgtgatgatagtattagcggtaggatctatcgtc
gttgtggttgccatgtatggtttctcgaccgtggctgacttttctaaaatttgtgcgccg
tggttatttgttatctttattgcgggttcatttaccttattcccagtgttatcaaatcat
gttattggcagtaccacattaacgggctggcaagacttcatgaccataggtgacagctca
atttggactggattaaatgacaaaggtgaacccggtatcggtttacttgaagtgataggc
tttgcgtgggccgctaactcaattactcacttcggtttgattgacatggctattttccgc
ttcgcaaagcgtaaaagttatggtttgatttcaggtgttggtatgttcttcggccactac
ttagcatggatttctgctggtattatgggggcaggtaccgctgtactattaaaaaccact
attacccaactcgatccaggtgatgttgcttaccatgccttaggtttttcaggctttgtg
attatcattatcgctggttggacaacggctaacgccaatttataccgtgcaggccttgcc
gcgcagtcaatatttgttaatcattctcgtgaacgtaccaccgccatagtgggcttagtc
actgtcgtgatagcgtgtttcccatttgtgttttcgcagatgttaccgttactgacgtat
gccggtcttttagttgtaccagtgggtggtattgtatttgctgagcacgtgttattccct
aagattggcttaacccgctattgggctaaatatcaaaaactgtcaaaaagcacaccggca
attgcatcttgggcattagcgttagtatttgggtttggtttaaatagtcttgatattatt
tcattctattacttatttattccaacgtggatattcaccattataatttataccgtatta
gctaaaaagtatggtgccgatttagattatacaggtgctatattattagatgagaaagaa
cagcaacaaataacagagtatcaagatgaaatggctaaagacgataagcctcatgttgaa
gatggcagcaaactcactaagttattaaatagcttcgcggtgatctctttgatggttatt
agcatactggctgcgaaagtgatgttttatagcccaacaatgacaatctatgcagagaat
aagtctttatttgaaacggtttgttttgtttgtacgataatttattttagttgttcatac
attgctctgaaactgagggatccccacgaatttaatagcatgcttgtgggtccttga

DBGET integrated database retrieval system