KEGG   Shewanella frigidimarina: Sfri_2045Help
Entry
Sfri_2045         CDS       T00395                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00071  Fatty acid degradation
sfr00280  Valine, leucine and isoleucine degradation
sfr00281  Geraniol degradation
sfr00310  Lysine degradation
sfr00360  Phenylalanine metabolism
sfr00362  Benzoate degradation
sfr00380  Tryptophan metabolism
sfr00410  beta-Alanine metabolism
sfr00627  Aminobenzoate degradation
sfr00640  Propanoate metabolism
sfr00650  Butanoate metabolism
sfr00903  Limonene and pinene degradation
sfr00930  Caprolactam degradation
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01120  Microbial metabolism in diverse environments
sfr01130  Biosynthesis of antibiotics
sfr01212  Fatty acid metabolism
Module
sfr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sfri_2045
   00650 Butanoate metabolism
    Sfri_2045
  Lipid metabolism
   00071 Fatty acid degradation
    Sfri_2045
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sfri_2045
   00310 Lysine degradation
    Sfri_2045
   00360 Phenylalanine metabolism
    Sfri_2045
   00380 Tryptophan metabolism
    Sfri_2045
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sfri_2045
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sfri_2045
   00281 Geraniol degradation
    Sfri_2045
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sfri_2045
   00627 Aminobenzoate degradation
    Sfri_2045
   00930 Caprolactam degradation
    Sfri_2045
Enzymes [BR:sfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sfri_2045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABI71891
UniProt: Q082C4
Position
2423833..2424525
Genome map
AA seq 230 aa AA seqDB search
MELITVVIENNVHVITLNNGKVNAISPEVIAQINSALDHAEQQNAVVILTGQPGILSGGY
DLKTMKQSSQAAIALVTAGSTLARRMLSFPTPIIGACSGHAIAKGAFLLLSCDYRIGSTG
PFKIGLNEVAIGMTMHQAGIEIARNRIPQNYLSRAVINAELFAPEQAVLAGFLDQVVEPE
QLMDTAHAVAKHMQTLNMPAHLGTKLKERQSILASLDAAIEQDKLITLNL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggaactgatcaccgtagtaatcgaaaacaatgtacatgttattaccctgaacaatggc
aaagtgaatgcaatatcgcctgaagtcatcgctcaaattaacagtgcattagaccacgca
gaacaacaaaatgcggttgtcatattaactggccaacctggtattttatctggcggttac
gatcttaaaaccatgaagcaaagttcacaagctgcaattgctttggtcactgcgggctca
acattagctcgcagaatgctgtcattcccaacaccgattattggtgcctgttcaggccat
gccattgctaaaggcgcatttttactactcagctgtgactaccgtattggcagcacaggg
ccatttaaaattggcctaaacgaagtggctattgggatgacaatgcatcaggctggcatt
gaaatcgcgcgtaatcgtattccgcaaaattatctgtcgcgcgcggtaatcaatgctgaa
ttgtttgcaccagaacaagctgtattggcaggttttcttgatcaagtggttgagccagaa
caactcatggacactgcacacgccgtggctaaacacatgcaaacactgaacatgcctgcg
catttgggaaccaagttaaaggagcgtcagtctattcttgcctctttggatgcagcaata
gaacaagataagcttattacattgaatttataa

DBGET integrated database retrieval system