KEGG   Shewanella frigidimarina: Sfri_2063Help
Entry
Sfri_2063         CDS       T00395                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00071  Fatty acid degradation
sfr00072  Synthesis and degradation of ketone bodies
sfr00280  Valine, leucine and isoleucine degradation
sfr00310  Lysine degradation
sfr00362  Benzoate degradation
sfr00380  Tryptophan metabolism
sfr00620  Pyruvate metabolism
sfr00630  Glyoxylate and dicarboxylate metabolism
sfr00640  Propanoate metabolism
sfr00650  Butanoate metabolism
sfr00900  Terpenoid backbone biosynthesis
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01120  Microbial metabolism in diverse environments
sfr01130  Biosynthesis of antibiotics
sfr01200  Carbon metabolism
sfr01212  Fatty acid metabolism
sfr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sfri_2063
   00630 Glyoxylate and dicarboxylate metabolism
    Sfri_2063
   00640 Propanoate metabolism
    Sfri_2063
   00650 Butanoate metabolism
    Sfri_2063
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sfri_2063
   00072 Synthesis and degradation of ketone bodies
    Sfri_2063
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sfri_2063
   00310 Lysine degradation
    Sfri_2063
   00380 Tryptophan metabolism
    Sfri_2063
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sfri_2063
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sfri_2063
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sfri_2063
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfr04147]
    Sfri_2063
Enzymes [BR:sfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sfri_2063
Exosome [BR:sfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sfri_2063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABI71909
UniProt: Q082A6
Position
complement(2445791..2446972)
Genome map
AA seq 393 aa AA seqDB search
MREAVIVSVARTPIGKAYRGAFNDLSAPTLAAVAVNAAVERAGIDPNEIEDCIFGAALTQ
GNQGMNFGRQVAMAAKLPVSVPGMTVDRQCSSGLMSIAIAANHIVCDGANVVVAGGCDSI
SLVQNDKMNMHRAVDPSVKAYRPAIYMPMLDTAEVVANRYCISREAQDAYALISQQRTAD
AQAAGKFDDEIVPVTCTKLVMDKASRDITKEQVTLTQDEGNRPSTNIEGLAGLKAVKDNG
SITGGNASQLSDGAAAVVVMERKLAEQRGLKPLGVYRGMVVVGCEPDEMGIGPIFAIPKL
LERHSLNIDDIGLWEINEAFAVQVIYCAEKLGIPYDRLNVDGGAISIGHPYGMSGTRMVM
HALIEGKRRGVKYVVISMCIGGGQGAAGLFEVL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagccgttattgtatctgtagcaagaaccccgatcggtaaagcataccgtggc
gcatttaacgatttatctgcaccgacattagccgcagttgctgttaatgcagccgttgaa
cgtgcgggtattgacccgaatgaaattgaagattgtatttttggtgctgcgttaactcaa
ggtaaccaggggatgaactttggtcgtcaagtggccatggcggcaaaactgccagtgtct
gtgcctggtatgacggtagatcgtcaatgttcatcaggattaatgtctattgctatcgcg
gctaatcatattgtttgtgatggcgccaacgtggtagttgctggcggttgtgactcaatc
agcttggttcaaaacgataaaatgaacatgcaccgagccgtcgacccaagtgttaaagcg
tatcgtccagcgatttatatgccgatgcttgataccgccgaagtggttgctaatcgttat
tgcatctcgcgtgaagcacaagatgcttatgcattaatctcgcaacaacgcactgctgat
gcacaagctgcaggtaaatttgatgacgaaattgtgcctgttacgtgtacaaaattggtg
atggataaagccagcagagatatcactaaagaacaagtcaccttaactcaagatgaaggt
aatcgtccttcaaccaatattgaaggcttagcgggtttaaaagcggtaaaagataacggc
tcaattactggcggtaacgcatcgcaactgtctgacggtgctgccgctgttgtggtaatg
gaacgaaaactcgctgagcaacgcggtcttaagccgttaggtgtttaccgaggcatggtg
gttgtaggttgtgagccagatgaaatgggcataggtccaatttttgccattcctaagttg
cttgaacgtcatagtttgaatattgatgacattggtttgtgggaaatcaatgaagcgttt
gcggttcaggtcatttactgtgcagaaaaattgggcattccatatgatcgtttaaacgtc
gacggcggcgcaatttctattggtcatccttatggcatgagcggtactcgtatggtgatg
cacgcgttaattgaaggtaaacgtcgtggtgttaaatacgtggtgatcagtatgtgtatt
ggtggtggtcaaggcgctgcaggtttatttgaagtgttgtaa

DBGET integrated database retrieval system