KEGG   Shewanella frigidimarina: Sfri_2342Help
Entry
Sfri_2342         CDS       T00395                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00020  Citrate cycle (TCA cycle)
sfr00310  Lysine degradation
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01120  Microbial metabolism in diverse environments
sfr01130  Biosynthesis of antibiotics
sfr01200  Carbon metabolism
Module
sfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sfri_2342
  Amino acid metabolism
   00310 Lysine degradation
    Sfri_2342
Enzymes [BR:sfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sfri_2342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABI72188
UniProt: Q080X7
Position
complement(2788842..2790038)
Genome map
AA seq 398 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKPGEQVTRDQNLVDIETDKVVLEVVAPEDGSISELL
FQEGDTVLGEQVIANFVAGVVSGQEVTKAEASGPAVVATTEAASDESNDALSPSVRRVIA
EHNLDASKIKGSGVGGRVTKDDVDAFLKSAPAKAAAPAAPVAPLEGRSEKRVPMSRLRKT
IAKRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYIKAVTEALK
RFPEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMNLAEIEKAVRELAIKGR
DGKLSVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPM
MYLALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaattaaggtacccgtattaccagaatctgttgctgatgcaactattgct
acttggcatgttaaacctggtgaacaggttactcgtgatcaaaacttagttgatatcgag
acagacaaagtcgtgttagaagtggtagcaccagaagacggttcaatttctgaattgtta
ttccaagaaggcgataccgttttaggtgagcaagtgattgctaattttgtcgctggtgtt
gtgtctggccaagaagtgactaaagctgaagcttcagggcctgctgtcgtggcaacgacc
gaagctgcttctgatgaatctaatgatgcattaagcccatctgttcgtcgtgtgattgcc
gaacataatcttgatgccagtaaaattaaaggttctggtgtgggcggacgtgtaactaag
gatgatgtagatgcattccttaagtcagctcctgctaaagccgctgcaccagctgctcct
gtagcacctttagaaggtcgtagtgagaagcgtgtaccaatgtcacgtcttcgtaaaact
atcgcaaaacgtcttttagaagcgaaaaattcaacggcaatgttaactacgtttaacgaa
gttaacatgaagccaatcatggatattcgcaaacagtaccaagacattttcgaaaaacgc
catggtattcgtttaggctttatgtctttctatatcaaagctgtgacagaagcgctaaaa
cgtttcccagaagttaacgcttctattgatggtgatgacattgtttatcataactatttc
gacatcagcatcgctgtatcaacgcctcgtggtctggtaactccagtcttgcgtgacact
gataccatgaacttagctgaaatcgaaaaagcggttcgtgaattagccattaaaggccgt
gacggtaaattatctgttgctgacatgactggcggtaacttcactgtgactaacggtggt
gttttcggttcactcatgtctacgccaattttgaacctgccacaaagcgcaatcttaggc
atgcatgccattaaagatcgcccaatggcagtcaatggtcaggttgaaatcctgcctatg
atgtacctagcactctcttacgaccaccgtattgttgatggtcgtgagtcagttggcttc
ttagtcgcgattaaagacttcttagaagatccaactcgtctgctacttgatctgtaa

DBGET integrated database retrieval system