KEGG   Shewanella frigidimarina: Sfri_2363
Entry
Sfri_2363         CDS       T00395                                 

Definition
(GenBank) protein of unknown function DUF1305
  KO
K11895  type VI secretion system protein ImpH
Organism
sfr  Shewanella frigidimarina
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfr02044]
    Sfri_2363
Secretion system [BR:sfr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Sfri_2363
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ABI72208
UniProt: Q080V7
Position
complement(2814941..2815948)
AA seq 335 aa
MTQQVMNNQLQAIIDTPSEHDFYQAVYQFQQQLSQGREQGYKVGYDAIPSQELLRFKSDQ
HLGFPGQAISKVAPTSTSQTDKVAADLHISFMGLTGPSGVLPSHYTELLLERLRLKDNGM
RDFYDLFNHRLISLFYRSWEKYRFSANYQSPETGVTDSFTHVLSLLSGNKSLNRYYAGFC
HTKTPSAESLRRMLNDFTGCNVNILSFQGRWQSLAKTEQTRMASRSMPEGQYARLGVDAS
IGNRVWDINSSVSIHIKPKEGASVNAFMPGTASYQSLKKLVSNYLGQSVKYKIFLEIKQQ
DAPTAQLSKSAIGLGLGCGLMSRAENGQQIKSLMI
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgacccagcaagtaatgaataatcagttgcaggcgataatcgatacgccatcagaacat
gacttttaccaagccgtttatcagtttcaacaacaattatctcaagggcgagagcaaggt
tataaggtgggttatgacgccattcccagccaagagttgttacgttttaagtctgatcaa
catcttggttttccaggacaagcaatcagcaaagtagcgcctacatcgacaagtcaaact
gataaagttgccgccgatttgcatatatcatttatgggattaaccggacccagtggtgtt
ttgccttcacattatactgagttgctactagagcgcctgcggcttaaagataatgggatg
cgtgacttttatgatttatttaaccatcggctgatctcactattctatcgttcatgggaa
aagtatcgtttttcggcaaattatcaatcccctgaaacaggcgttaccgacagctttacc
catgtattgagtttgcttagtggtaacaaatcattaaatcgctattacgcaggtttttgt
cacactaaaacgccgagtgctgagtcgttacgaagaatgctaaatgattttactggctgt
aatgtaaatattttgtcttttcaaggacgttggcagtctctcgcgaaaacagagcaaacc
cgaatggccagtcgaagtatgccagaagggcaatacgcccgtttaggtgttgatgccagt
ataggtaaccgggtatgggatattaattcaagtgtcagtattcatataaagccgaaggaa
ggcgcatcggttaacgcttttatgcctggaacagccagttatcaatcacttaaaaaacta
gtctcaaactatttaggccagtcagtgaaatacaaaatttttctagaaataaaacaacaa
gatgcacctacagctcaattatcaaagtccgcaatcggactagggttaggttgtggccta
atgagccgtgcagagaatggacaacaaataaaaagcttaatgatttaa

DBGET integrated database retrieval system