KEGG   Shewanella frigidimarina: Sfri_2364
Entry
Sfri_2364         CDS       T00395                                 

Definition
(GenBank) protein of unknown function DUF879
  KO
K11896  type VI secretion system protein ImpG
Organism
sfr  Shewanella frigidimarina
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfr02044]
    Sfri_2364
Secretion system [BR:sfr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Sfri_2364
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABI72209
UniProt: Q080V6
Position
complement(2815945..2817774)
AA seq 609 aa
MNQELLEYYNRELAFIRHMGAEFAEQYPKVAGRLRLSDEHVEDPHVSRLIEAFSLLTAQI
RQKLDDSFPELTEALLGQLYPDYQAPIPSMSVIKVTTENLSTTGVLLPRATQVDTQVEGM
KTCHFQTSYDMKLWPIEVQKAQFQNAPFNAPEPQCPERAKAIIKLDIACEFDEISMPSLG
VDKLRFFLNGQDHQTFQLYQLLFEHSLGFALVNEQQTVCKFLTKRHLKAVGFEDEQQVIP
YSQRTSSGYRLLLENFIFPEKFLFFDIDDLDGSWQGIDNKFSLYIYLKEGSQDLEKQVSA
NHFLLGCTPVINLFEQKLEPVSIDASQYEYKLAARYSDSEVTEIISIEDVIAYDPKDNKV
EVTPFYGESHPQYLGHNNLFWHVRRESASWSGGYAELGTESFLSLVDHNFKGFKSEDDYG
AWILSITAQCSNRNLPAHLPFGTNEPKMFVPERADIIKHVKCLLAPTLPVRASLSDASRW
QLVTHLSIDSFSGKDALSNLKETLKLYDFKCSPENKNLIENIHSVQVSPDTARVNQHGRI
SFCSGSHIEITFIKDHYSGSGVFFFCTILDHFFAQFAAINSFTRLSMRFKDHNSIAYTWP
ARAGQRPLL
NT seq 1830 nt   +upstreamnt  +downstreamnt
gtgaatcaggaattattggaatattacaatcgtgagctggctttcattcgtcatatggga
gcggaatttgctgagcaatatcctaaagtggccgggcgtttacgcttaagtgatgaacat
gttgaagatcctcatgtttcacgattaattgaagcattctctttgctaacagcacaaatt
aggcaaaaacttgacgatagttttcctgaattaaccgaggcgttattaggccagttatat
cccgattaccaagcgccaataccgtctatgtcagttatcaaagtcaccactgaaaacttg
tcgactactggcgtgttattacccagggcaactcaggtagacactcaggtagaggggatg
aaaacgtgccattttcaaacatcatatgacatgaaattatggcccattgaagtgcaaaaa
gcccagtttcaaaatgcaccgtttaatgccccagaaccacaatgtccagaacgtgctaaa
gcgattattaagcttgatatcgcctgtgaatttgacgaaattagcatgccgagccttggg
gttgataaattacgctttttcttgaatggccaagatcatcaaacgtttcagctttatcaa
ttgttatttgaacacagcctaggttttgctttagtgaatgagcagcaaactgtgtgtaag
tttttaaccaaaaggcatttaaaagcggttggctttgaagatgaacaacaagtcatacct
tacagccaacgtactagttctggttatcgattattattagaaaattttatttttccagaa
aaattcttgttttttgacattgatgatttagacggcagctggcaagggatcgacaataag
ttttctctttatatatatttaaaggaaggctctcaggatttagagaagcaagttagtgcc
aatcattttctgttaggttgtacgccagtgattaatttgtttgaacaaaaattagaaccg
gtgagtattgatgcgtctcagtatgaatataaattggctgcccgttattctgactctgaa
gtgactgaaatcatcagcattgaagatgttattgcttatgatcctaaggacaacaaggta
gaagttaccccattttatggtgaatcgcatccgcaatatttaggtcataataatttgttt
tggcatgttagacgtgagtctgctagttggtctggtgggtatgctgaattaggcactgaa
tcatttttatctctagtcgatcataactttaaaggatttaagtccgaagacgactatggc
gcttggatattaagtattaccgctcaatgcagcaaccgtaatttaccggcgcatctcccg
tttggtactaatgagccaaaaatgttcgtacctgaacgtgccgacattattaagcacgta
aaatgtttgcttgcgcccacgttaccggtacgtgcgtcgctgagcgatgcttcgcgctgg
cagctagtgactcatttatctattgatagttttagtggtaaagatgcactgtctaactta
aaagaaacccttaaattatacgattttaagtgttcaccagaaaataaaaacttaatagag
aatatccattctgttcaagtgagccccgatacagccagagttaaccagcatggcaggatt
agcttttgcagtggcagtcatattgaaattacctttattaaagaccattattctggcagt
ggcgtgtttttcttttgcactattttagaccacttctttgcacaatttgctgcaatcaat
agttttactcgcttgagcatgcgctttaaagatcataattcgatagcttatacctggcca
gcacgagctggacaaaggccgctgctatga

DBGET integrated database retrieval system