KEGG   Shewanella frigidimarina: Sfri_2366
Entry
Sfri_2366         CDS       T00395                                 

Definition
(GenBank) virulence protein, SciE type
  KO
K11898  type VI secretion system protein ImpE
Organism
sfr  Shewanella frigidimarina
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfr02044]
    Sfri_2366
Secretion system [BR:sfr02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Sfri_2366
SSDB
Motif
Pfam: ImpE TPR_19 TPR_20
Other DBs
NCBI-ProteinID: ABI72211
UniProt: Q080V4
Position
complement(2818268..2819056)
AA seq 262 aa
MKQIQQMLQSGQLQDAIQLVETQLKDDPMNIDLKGQHVELLCINGELERADKQLNFLVQK
HPDFLIGAANLRQLIRAEQARQDFMAGKAVPQLFAESDAHVEALMKLRLAMVDAQDDVTQ
CANSLETLRPEINLVLNDITHQEIRDLDDTLGGFIEIFGTDGNFYLAQLSEIDYINFKPV
TSLLEMVWRRVDLAIKNGPSGEAHIPMIYGGSETDAQKLGRETDWHEIATNVVAGKGLKM
WFVDDNAIALNQITKVTTPVLQ
NT seq 789 nt   +upstreamnt  +downstreamnt
atgaaacaaattcaacaaatgctacagagcggccaactacaagatgcaattcagttagtt
gagacacaattaaaagacgacccgatgaatattgacttaaaaggtcaacatgttgagttg
ttgtgtattaatggtgaacttgagcgtgcagacaaacaattaaactttttagtgcaaaag
catcccgactttttaattggcgcagcaaatttacgtcagctgatccgtgctgaacaagcc
cgacaagattttatggcgggcaaagctgtaccacaactttttgctgagtctgatgcgcac
gttgaagcattaatgaaattacgtttagcaatggttgatgctcaagatgatgtgactcag
tgtgcaaacagccttgaaactctgcgtccggaaataaacttagtattaaatgatatcact
catcaagaaattcgtgatttagatgacactttaggtggtttcatcgaaatttttggtact
gacggcaatttttatttagcgcagttatctgaaattgattatatcaattttaaacctgta
acttcattactggaaatggtttggcgccgggttgatcttgccattaaaaatggaccaagt
ggtgaagcgcatattccaatgatttatggtggcagtgaaactgatgcgcaaaaactggga
cgagaaaccgattggcatgaaatcgcgactaatgttgttgctggcaagggcttaaagatg
tggtttgtcgatgataatgctatcgcattaaatcaaataactaaagttacgactccagtg
ttgcagtag

DBGET integrated database retrieval system