KEGG   Shewanella frigidimarina: Sfri_2368
Entry
Sfri_2368         CDS       T00395                                 

Definition
(GenBank) protein of unknown function DUF877
  KO
K11900  type VI secretion system protein ImpC
Organism
sfr  Shewanella frigidimarina
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfr02044]
    Sfri_2368
Secretion system [BR:sfr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Sfri_2368
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ABI72213
UniProt: Q080V2
Position
complement(2820658..2822151)
AA seq 497 aa
MSMEAASLDAVSEEQAQSVSILEQAIFATKQTDSSRAEELIRSLTEEALKGTVQWDKNLT
VTFNKAITRLDDIISKQLAAIMHNEELQKLEGSWRGLHHTVKNSETNETLKIRVMSLSKK
ELHKDLSKAVEFDQSQMFKKIYEAEFGTPGGEPYGCLVGDYEFSNHPEDVETLSLISNVA
AAGFCPFVSAAGSSLFGFDEWTELSKPRDLEKVFESLEYTQWRSFRDSDDSRFVTLTMPR
VLARLPYGEATKPVEEFCYEEFELDLESGRAKVADHDDYCWMNAAYVMATNMGQAFSKYG
FCTAIRGAEGGGKVEGLPAHVFTSDDGDPDLKCPTEIGITDRREAELSKLGFLPLCHYKH
TDYAVFFGSQSCQKPKIMSNHDATANAAISARLPYLMATSRFAHYLKVMARDKIGSFMEA
EDVESWLNRWILSFVNASEGGGQEIRAKYPLADAKVEVKEIPGQPGSYNAVAWLRPWLQM
EELTASLRLVAKIPKVG
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgagcatggaagctgcgtcattagatgctgtatctgaagaacaagcacaaagtgtttct
attttagagcaggccatttttgcaaccaagcaaaccgattcttcgcgtgctgaagagctt
attcgttcattaacggaagaggccttgaaaggcactgtgcaatgggataaaaacctcaca
gttacttttaacaaggcaattactcgtttggacgatattatttctaagcaattagctgcc
atcatgcacaatgaagaactgcaaaaactggaaggcagttggcgtggattgcatcataca
gtgaaaaactctgaaacaaatgaaacgcttaaaattcgtgtcatgagtttgtccaaaaaa
gaacttcacaaagatttgagtaaagcggttgagtttgatcagagtcaaatgttcaaaaaa
atctatgaggctgaatttggcaccccgggcggagaaccttatggttgcttagtcggtgat
tatgagtttagtaatcatcctgaagatgttgaaacattatcattgatatctaatgttgca
gccgctggcttctgcccatttgtttctgctgctggttcttctttattcggttttgatgag
tggacagaactcagtaaaccacgcgatcttgaaaaagtatttgaatctttagaatacacg
caatggcgctctttccgtgacagtgatgactctcgttttgtcaccttaaccatgccacgt
gtgcttgcccgtcttccgtatggtgaagcaacaaaacctgttgaagagttttgctatgaa
gaattcgaattagatttagaaagtggtcgtgctaaagtcgctgatcacgatgactattgc
tggatgaatgccgcgtatgtcatggcaactaatatggggcaggcatttagtaaatatggt
ttctgtaccgcaatccgtggcgccgaaggtggtggtaaggttgaaggattaccagctcat
gtatttaccagtgatgatggtgatccggatttaaaatgcccaacagaaattggcattacc
gatcgccgcgaagctgaattaagtaagttgggtttcttgcctctatgtcattacaagcat
actgattatgccgtgttctttggctctcaatcttgccaaaaacctaaaataatgtctaac
catgatgctaccgcgaatgcggccatttctgcacgtttaccttacctaatggcaacatca
cgttttgcgcattatcttaaagtgatggctcgagacaaaattggtagtttcatggaagct
gaagacgtcgagtcttggttaaatcgctggattttatcatttgttaatgcttcagaaggt
ggtgggcaagagattcgtgccaagtacccattagcagatgcaaaagttgaagttaaagag
atccctggtcaacctggttcatacaatgctgttgcatggttacgtccttggttacaaatg
gaagaactgacagcctctttacgtttagtcgcgaagatccctaaagtaggataa

DBGET integrated database retrieval system