KEGG   Shewanella frigidimarina: Sfri_2369
Entry
Sfri_2369         CDS       T00395                                 

Definition
(GenBank) Uncharacterised conserved protein UCP028301
  KO
K11901  type VI secretion system protein ImpB
Organism
sfr  Shewanella frigidimarina
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfr02044]
    Sfri_2369
Secretion system [BR:sfr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Sfri_2369
SSDB
Motif
Pfam: T6SS_VipA YwpF TFIID_20kDa
Other DBs
NCBI-ProteinID: ABI72214
UniProt: Q080V1
Position
complement(2822151..2822651)
AA seq 166 aa
MSVHDKLKRVRKPRVHITYDVETEGTVVKKELPFVIGVTGDFTGHNTADLKPLKDRRFVQ
IDRDNFNDVLKRMSPQLNISVPNTLAGDDTEMKVALQFSSIEDFEPAAIVNQVEPLKKLM
ETRNKLRDLMTKVDRSENLENILEEVLNNTTSLDRLAGELNLKGAE
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagtgtacatgataaattaaagcgagtaagaaaacctcgtgttcatattacctacgat
gttgaaacagaaggtacagttgtaaaaaaagaactgccttttgttatcggtgttacgggt
gattttactggacacaacaccgcagatttaaagccattgaaagaccgccgttttgtgcaa
atcgatcgcgacaacttcaatgatgtattaaagcgtatgagtccccaattaaacatttca
gtacctaacacgcttgccggtgatgatactgaaatgaaggtagcattacaatttagcagc
atcgaagacttcgagcctgcagctattgttaatcaggttgaaccattgaaaaaattaatg
gaaacccgcaacaaactccgtgatttgatgaccaaagttgatcgttctgagaatctcgaa
aatatcttagaagaagtgttaaataacacaaccagcctagatagattagctggtgaactt
aacctcaaaggagcggaataa

DBGET integrated database retrieval system