KEGG   Shewanella frigidimarina: Sfri_2373Help
Entry
Sfri_2373         CDS       T00395                                 

Definition
(GenBank) ImcF domain protein
  KO
K11891  type VI secretion system protein ImpL
Organism
sfr  Shewanella frigidimarina
Pathway
sfr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Sfri_2373
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfr02044]
    Sfri_2373
Secretion system [BR:sfr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Sfri_2373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C YajC AAA_33 DUF4131
Motif
Other DBs
NCBI-ProteinID: ABI72218
UniProt: Q080U7
Position
complement(2825557..2829105)
Genome map
AA seq 1182 aa AA seqDB search
MSLKSIGKGIVDTLKSKWAITIIGFLCLALLIWFGGPLVAIAGYEPLASAATRVILLLVI
VIIFGAIHFTRQLKNKKQSEKMVDSLINGEEGNSVTGDDLAKSEITVLQNKMTQALDILK
NTKLTKNKSIYELPWYIMIGPPGSGKTTAIQHSGLEYPLKEKMGVDMIEGVGGTRHCDWW
FTNKAVLIDTAGRYTTQDSHVKQDSRAWQGFLGLLKKYRPVRPINGVIISMGMSDLLNQT
KTERNLHARAIKQRLQELQNQLGMTFPVYVLFSKSDLVAGFNEFFDDLTKEDCEQIWGIT
FPLNADTEDTDIVSSFNKEFHDLLLNLNARLNSRLKNERDLERRAAIYEFPKQLRLLQSS
ADDFLKEIFAPNAYEEAPLLRGVYLTSATQEGTPIDHLSSHLSSGIKSKAKTFAANKQRS
YFIKRLLEDVIFPEKNLASTNRKHTNHNKLLRKVSVGIAAGVTLLASYVWWQSYDWNRQL
IDDTYQGVTTYKTITSGGLNAKSDVITLTKGLTLIRDLPVGFGTDKPEDAYTFGLYQGDK
LKQPATAAYHRALETHLMPYLQSVLSAEMDANGEHLNYLYETLKTYLMLYFPEHFDKSDV
QVWFSAYIDRNIVGDVNGEVRKELNKHIDTLLSLGVRGHQYDSMTVDSARINLTMLPLVE
RAYQRLKSDFSNSSIPDFKLVDILSLDSLDGLVFTSGRQFNQGIPGLYTFNGFHGIFSIE
KNKIIKNLTADSWVYGDELVDLDEQAKAQITQELENRYIRDYIFYWEDFLSDLAIKPYST
REEAESVTAALASPDQPIKTIITAVQKNVNLTKLPADSNNLKAAAEVAGNISDVAFRSKK
ARLNRLLPDTAIELDIDLPGKDVEFAFAELLKINPADIDKIQTTLRALNRNYNKLSMQSE
GQGNVVNQATEESFAQLGSSLSEQLMDLPYPVKNWLSEVAYRTRSFAKSNQSQRFNGIWR
SQVLAEFNRAIAGRYPFDRKSSEDVRLKDFSKFFGYGGTLDKFWDQYLASHVDTSKKPWR
FKRNIGIRNDILEMYQRAEIIKEAFFEPGSKQPIVNFSLEPELLDRSVSMFLFEIDSQQL
KYRHGPTRKELFTWPGPGANNETRIAFSPPNGGRSINKKYEGEWSFFKLLDELSKKRPQT
KKDGKLLINLKGYNAVLKLTANSVNNPFWMANMEKFRCPANL
NT seq 3549 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaaaatcaattggcaaaggaattgtcgacacacttaagtctaaatgggcaatt
accataataggttttttatgtttggctttacttatttggtttggtggtcctttagtggct
atagctgggtatgaaccattagcatcagcagcaacacgggttatcttactactggttatt
gttattatttttggtgccattcactttactcgacaactcaagaataaaaaacaaagcgag
aaaatggttgatagcttaattaacggtgaagagggtaactctgtgaccggtgatgactta
gccaaaagtgaaatcactgttttacagaataaaatgacccaagcgttagatattcttaaa
aataccaagctaactaaaaataaaagtatttacgaattaccttggtacatcatgattggt
ccgccaggaagtggaaaaaccaccgcgattcagcattcaggtcttgaatacccattaaaa
gaaaaaatgggtgtagatatgattgaaggcgttggcggtacaagacactgtgattggtgg
tttaccaataaagcagtattaattgatacggcgggtcgttataccactcaagatagtcat
gtaaaacaagactctcgggcatggcaaggttttctggggttattgaaaaaatatcgccct
gttcgtcctattaatggggtgataatcagcatgggtatgtctgatttattaaaccaaacc
aagactgagagaaacttacatgcgcgagcaattaagcagcgtttacaagaactgcaaaat
caactgggtatgacttttccggtatatgttttattttctaaatcagatttagttgccggt
tttaatgagttttttgatgatttaaccaaagaagattgtgaacaaatttggggtattacc
ttcccattaaatgcagatacagaagacactgatattgttagttcatttaataaagaattt
catgatttattattaaatttaaatgcaagattaaatagccgcctaaaaaacgaacgcgac
ctagagcgtcgtgcggccatctatgagtttccaaagcagcttcggttattacagagctca
gcagatgattttcttaaagaaatttttgcgcctaatgcatatgaagaagcaccgctattg
cgtggtgtttacttaaccagtgcaactcaagaaggtacgccaatcgatcatctttctagt
cacttatctagtggcattaagagtaaagctaaaaccttcgccgcaaataaacaacgcagc
tattttattaaacgcctgttagaagacgttatttttccagagaaaaatttagcatcaacc
aatcgaaagcatacaaaccataataaacttttacgtaaagtatcagtaggcattgctgca
ggtgtgaccttgcttgctagttatgtttggtggcaaagttatgattggaatagacaattg
attgatgatacctatcaaggtgtcacgacatacaaaaccattaccagtggtgggttaaat
gctaagtcagatgtgattacacttaccaaaggcttaacattaattcgtgatctccctgtt
ggttttggtactgataaacctgaggatgcatatacctttggtttgtatcaaggagataag
cttaaacaacctgctacagcggcttatcaccgtgctttagaaacacatttaatgccttac
ctacaaagtgtgcttagtgcagaaatggacgctaatggtgagcaccttaactacctatat
gaaacattaaaaacctatttaatgttgtattttcctgagcattttgacaaaagtgatgtg
caagtctggttctccgcttatatcgatagaaacattgttggtgatgtaaatggtgaggtt
aggaaagagctaaataagcatatagatacattactgtctttaggggttagaggtcatcaa
tacgacagtatgacagttgatagtgctcggattaatttgaccatgttacctctggttgag
cgcgcatatcagcgtttaaaaagtgatttttcaaacagcagtatcccagattttaaactg
gttgatattctgagtttagacagtttagatggtttggtgttcaccagtggtcgccaattt
aatcaaggcattcctggtctttatacttttaatggttttcatggcatttttagtatagaa
aagaataagataataaaaaacctaaccgcagacagttgggtatatggtgatgagttagtt
gatttagacgaacaagccaaagcgcagattacccaagagttagaaaacagatacattcgt
gattatattttctattgggaagatttcttaagcgaccttgctatcaaaccatattcaaca
cgtgaggaagctgagagtgttactgcagcacttgctagcccagatcaaccgatcaaaacc
attattaccgcagttcagaaaaatgtgaatttaactaagcttcctgccgattcaaataat
ttaaaggccgcggcggaagtggccggtaatatttctgatgttgcatttcgatctaaaaaa
gcacgattaaataggctattacccgatacagcaatagagttagatattgatttgccgggc
aaggatgtggaatttgcttttgcagaattgctcaaaatcaatcccgctgatattgataaa
attcaaacgacgttacgcgctcttaatcgaaactacaataaattatcaatgcagtcagaa
ggacaaggtaacgttgttaatcaagccacagaagaaagctttgctcaactaggttctagt
ttatctgagcaattgatggatctaccttatccagtaaaaaattggttaagtgaagtggct
tatcgtactcgctcgtttgccaaatccaatcaaagtcagcgtttcaacggtatttggcgt
tcgcaagtgttggccgaattcaatcgagcgattgcagggcgttacccatttgaccgaaaa
tcgtcagaagatgtcagactaaaagacttcagtaagttttttggttatggcggcacctta
gataaattttgggatcaatacctcgcttcacatgtagataccagcaaaaaaccttggcgt
tttaagcgtaatatcggcattcgtaatgacattttagaaatgtatcaacgcgctgaaatt
attaaagaagcatttttcgaaccaggatctaagcagcctattgttaacttttcattagaa
ccggaattattagatagaagtgtgagtatgtttttattcgaaatagacagccaacagctg
aagtatcgacacggtcctactcgcaaagagttatttacgtggcctggccctggtgcaaat
aacgaaacacgaattgcattttcacctcctaacggcgggcgctctatcaataagaaatat
gagggtgaatggtcattcttcaaattattagatgaattaagtaaaaagcgtccacaaact
aaaaaagatggcaagttactcatcaatctcaaaggctacaacgctgtactgaaattgacc
gcaaacagtgttaacaatccattttggatggcaaatatggagaagtttagatgtcctgcg
aacctttaa

DBGET integrated database retrieval system