KEGG   Shewanella frigidimarina: Sfri_2476Help
Entry
Sfri_2476         CDS       T00395                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00430  Taurine and hypotaurine metabolism
sfr00620  Pyruvate metabolism
sfr00640  Propanoate metabolism
sfr00680  Methane metabolism
sfr01100  Metabolic pathways
sfr01120  Microbial metabolism in diverse environments
sfr01200  Carbon metabolism
Module
sfr_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sfri_2476
   00640 Propanoate metabolism
    Sfri_2476
  09102 Energy metabolism
   00680 Methane metabolism
    Sfri_2476
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Sfri_2476
Enzymes [BR:sfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Sfri_2476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ABI72321
UniProt: Q080J4
Position
2955250..2956452
Genome map
AA seq 400 aa AA seqDB search
MSDKLVLVLNCGSSSLKFAIIDAQSGDDKVSGLAECFGLEDSRIKWKFDGGKNEAKLGAF
TAHREAVEFIVNNILAEHPELAAQIKAVGHRIVHGGEKFTRSVIVTPEVIQGIEDCASLA
PLHNPAHLIGIRAALASFPALPQVAVFDTAFHQTMPEKAYIYALPYKLYREHSIRRYGMH
GTSNIYICREAAKVLGKETKDTNIICAHLGNGASVTAIKDGKSVDTSMGLTPLEGLVMGT
RCGDLDPSIIFHLVKQLGYTLDEVNNLLNKQSGLLGISELTNDCRGIEEGYQDGHKGATL
ALDIFCYRLAKYIASYTVPLGRLDAIIFTGGIGENSDLIREKVLNLLAIFNFKVDDNLNK
AARFGQQGIITQVGSPIAMVIPTNEEWVIAEDAIKLITAK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaaattagtactcgtgctcaactgcggtagctcatcattaaaatttgccatc
attgatgctcaatcaggcgatgataaagtttctggattagctgaatgttttggtttagaa
gattcgcgcattaagtggaaatttgatggcggcaagaatgaagccaaattaggtgctttt
actgcgcatcgcgaagcggtagaatttatcgttaataacatcttggcagaacacccagaa
cttgcggcacaaattaaagccgttggtcatcgtatcgtccatggtggcgaaaagtttact
cgctcggttattgtgactcctgaagtcattcagggtattgaagattgtgcgtcattagca
cctctgcataatcctgcgcatttaattggtattcgtgccgcacttgcctcattcccagcg
ttgccacaagttgcagtatttgacaccgcattccatcaaaccatgcccgaaaaggcatat
atttatgcccttccttacaaattgtatcgtgaacatagcattcgtcgttatggcatgcat
ggtactagcaatatctatatttgtcgtgaagcagccaaagtcttaggcaaagagactaaa
gacaccaatattatttgtgctcatttaggcaatggcgcatcagtaaccgcgattaaagat
ggtaaaagtgtcgacacttcaatgggcttaaccccgcttgaaggtttagtcatgggtaca
cgttgcggcgatttagacccatcaattattttccatttagttaaacaacttggctatacc
cttgatgaagtcaataacctattgaataagcaaagtggtttactgggcatttcagagctc
accaacgattgtcgtggtattgaagaaggttatcaagacggtcacaaaggtgccacatta
gccttagatatcttctgctatcgtttagccaaatatatcgcctcttacactgtgccatta
gggcgtttagacgccattatctttactggcggtattggcgaaaactcagaccttattcgt
gagaaagtgcttaatttattagcaatatttaacttcaaagtcgatgataacttgaataaa
gcggctcgctttggccagcaaggcatcattactcaagtaggtagcccaattgctatggtc
ataccgacaaatgaagagtgggttattgccgaagatgccattaagctaatcacagccaaa
taa

DBGET integrated database retrieval system