KEGG   Shewanella frigidimarina: Sfri_2780Help
Entry
Sfri_2780         CDS       T00395                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
sfr  Shewanella frigidimarina
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sfr03009]
    Sfri_2780
Enzymes [BR:sfr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     Sfri_2780
Ribosome biogenesis [BR:sfr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Sfri_2780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ THDPS_N_2
Motif
Other DBs
NCBI-ProteinID: ABI72620
UniProt: Q07ZE4
Position
complement(3345929..3347017)
Genome map
AA seq 362 aa AA seqDB search
MKNLFLFCRSGYEKDCAAEIQQRATELNVGGFVKTNINDAYVIYQCFDDNGADTLVKELA
LSSLVFARQMFAAGELLSDLPEQDRVGPIVASLAALSKCGELRVETPDTNEAKELSAFCR
KLTVPLRQGLKKSGALLNAESDRRPIIHVCFIGPGKAYAGYSLSHNSSPHFMGIPRLRMA
ADAPSRSSLKLDEAFGAFLTKEEQETRCRSGLNAVDLGACPGGWTYQLVRRGMMVAAVDN
GPMDPKLMETGQVKHYRADGFRFEPPRKNVYWLVCDMVEKPARVAELMEAWAINGWFKEA
IFNLKLPMKSRYKEVSVILETIGAILTENEIDFKMQCKHLYHDRDEVTVHLWIFPEKGVS
YA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacctattcctattttgtcgctcaggctatgaaaaagactgtgcggcagaaatt
caacaacgggcaactgaattaaatgtgggtggttttgttaaaaccaacatcaacgatgcc
tatgtgatctatcaatgttttgacgataatggtgccgatacgttagttaaggaattggcg
cttagttcattagtttttgcgcgtcagatgtttgccgctggtgagttgttgagtgatttg
cctgaacaagatcgagtagggcctattgtggcttcattggccgcactgtcaaaatgtggt
gagctacgcgttgaaacgcctgacaccaatgaagcaaaagaattatctgcattttgtcgc
aaattgacagtgccgttacgtcaaggtttaaaaaagagcggcgcattgcttaacgctgag
agtgaccgccgtccaattattcatgtgtgttttatcgggcctggcaaagcgtatgcgggt
tattcgttaagccacaatagttcgccacattttatgggtattcctcggttaagaatggct
gcagatgcgcctagtcgttcaagccttaagttagacgaagcttttggagcctttttaact
aaagaagaacaagaaacacgttgtcgtagtgggttaaatgctgttgatttaggcgcttgt
cctggtggttggacttaccaattagttcgccgtgggatgatggttgctgctgttgataac
ggtccaatggatccaaaattgatggaaacaggccaagtgaagcattaccgtgcagatggt
tttcgttttgagccaccgcgtaaaaatgtgtattggttagtgtgcgatatggttgaaaag
ccagcccgagttgctgaattaatggaagcatgggcaattaatggttggtttaaagaagct
atttttaatcttaagttacccatgaaaagccgctataaagaagttagcgtgattttagaa
accattggtgccattttaactgaaaatgaaattgattttaaaatgcagtgtaagcacctt
tatcatgaccgcgatgaagtgaccgtgcatttatggatattccctgaaaagggtgtgagc
tacgcataa

DBGET integrated database retrieval system