KEGG   Shewanella frigidimarina: Sfri_3080Help
Entry
Sfri_3080         CDS       T00395                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
sfr  Shewanella frigidimarina
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Sfri_3080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ABI72917
UniProt: Q07YJ7
Position
3687824..3688204
Genome map
AA seq 126 aa AA seqDB search
MSQVESPIKIKVDTQYLEQQSDVADNKYLFSYTITIINLGDNKVTLKDRHWIITDADGEQ
NEVKGPGVVGETPTIAPNTAYQYTSGTVMETPVGFMQGSYGMENHKGERFVATIPPFRLA
VPGIFQ
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagttgaatcgcctattaaaattaaagtcgacacccaatacttagaacaacaa
tcagatgtcgccgataataaatacctatttagctataccattaccatcatcaacctgggt
gataacaaggtgactcttaaagaccgtcattggattatcactgacgctgacggcgaacag
aatgaagtaaaaggccccggtgttgtaggggaaacccccacaattgcacctaatacggct
taccaatataccagtggcactgtaatggaaacgccagtgggctttatgcaaggatcttat
ggtatggaaaatcataaaggcgagcgatttgtagcaacaattccgccttttcgtcttgct
gttcctgggatattccaataa

DBGET integrated database retrieval system