KEGG   Shewanella frigidimarina: Sfri_3505
Entry
Sfri_3505         CDS       T00395                                 
Name
(GenBank) major facilitator superfamily MFS_1
Organism
sfr  Shewanella frigidimarina
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-ProteinID: ABI73333
UniProt: Q07XD1
Position
4174754..4175992
AA seq 412 aa
MPRFITITAIAACYFVFAILLNSVGTVILQSINSFDISKTEASTLEGFKDLSIAFVSFFV
ASIIPRIGYKVALLIGLSIVTIACAITPMLGQFWVIKLLFMCIGVSFALVKISVYSVIGQ
LSDSIKAHSSLLNTIEGIFMLGSLSGYWLFSFYIHPDNDSSTHWLQVYYPLTAMVLVAMV
LVFCSSMTKPSQQDTPPSIVDGFVDMIKMSIKPLVLIFVMSVFLYVLIEQGIGSWLPTFY
NEVINLPSHISVQMASIFAASLAIGRLLAGQILKFINWHLFLNICLIGMALIIVFLLPLT
GASSGEEIKSIVDAPLIAYLLPLIGLMMAPIYPVLNSVMLSSLARHKHAPMTGLIVVFSA
FGGTTGSLITGYFFQEVGGKNAFYLALIPMVLLIISLYFFKQETQKSSVNKS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgcctcgttttatcactataactgccattgctgcttgttactttgtgtttgctattttg
ctcaacagtgttggtactgtaatcctgcaatcgatcaatagttttgatatcagtaaaaca
gaagcaagtacactggaaggttttaaagacttatctatcgcatttgtgtcattttttgtt
gcttcaattattccaagaattggctataaagttgcgctactcatcggattatcaattgtc
actatcgcctgtgctattacgccaatgctaggtcagttttgggtgatcaaactgctattt
atgtgcattggtgtgtcttttgcgttagtaaaaatatcggtttactctgttattggccaa
ttaagcgactcgataaaagcacattcatcattgctcaataccattgagggtattttcatg
ttgggcagtttatcggggtattggttatttagcttttacatccatcccgacaatgactca
tcaacccactggctacaagtttactatccgttaaccgcaatggtgttagtcgcgatggtt
ctcgttttctgctcatccatgaccaagccgtcacaacaagacacaccacctagtattgtg
gatgggtttgtcgacatgatcaaaatgagcataaaacctttggtactcatttttgttatg
tccgtgtttttatatgtgcttattgaacaaggcataggctcttggttacccacattttac
aatgaagtcattaacctaccgagtcatatcagtgtacaaatggcgagtatttttgcagca
tcactcgccattggacgcttactcgcggggcaaattctaaagttcatcaattggcattta
tttctaaatatctgtctcatcggtatggcgttaatcatcgtatttttactgcccctaact
ggagcaagttctggtgaagaaataaaatctatcgttgatgctccacttatcgcttattta
ttgccacttatcggcttaatgatggctcctatataccccgtgttgaactcagtaatgctg
agcagtttagcgcgtcacaaacacgctccgatgacggggttgattgttgttttctctgct
tttggcggcacgacaggctcgcttattactggttatttttttcaagaagttggaggaaag
aatgctttctatctagcccttatcccaatggtgctgttaatcatcagcctgtactttttt
aagcaagagactcagaaaagctctgtcaataagtcgtaa

DBGET integrated database retrieval system