KEGG   Shewanella frigidimarina: Sfri_3989
Entry
Sfri_3989         CDS       T00395                                 
Name
(GenBank) major facilitator superfamily MFS_1
  KO
K19576  MFS transporter, DHA1 family, quinolone resistance protein
Organism
sfr  Shewanella frigidimarina
Brite
KEGG Orthology (KO) [BR:sfr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sfr02000]
    Sfri_3989
Transporters [BR:sfr02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    Sfri_3989
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-ProteinID: ABI73814
UniProt: Q07W00
Position
complement(4756825..4758045)
AA seq 406 aa
MVNHMKDNENSGNTRIRILTYLMFFMFAMTSDAVGVIIPELINTFDLSMSQASAFHYMPM
LFIALSGLFLGFLADKLGRKITILIGLLLFALASFMFALGESFYYFLCLLALVGIAIGVF
KTGALGLIGDISANSKQHSSTMNTVEGYFGVGAMVGPAIVSYLLITGVSWKYLYFGAGVF
CLILCWLAYKADYPQLKRSSTQDINLASTFRMMRNPYALGYSLAIGLYVATEVAIYVWMP
TLLLNYEGELALIATYALTIFFTLRALGRFLGGWILNRYSWQQVMFWFSLAISLCYLGAM
MYGISAAVILLPLSGLFMSMMYPTLNSKGISCFPVDQHGSVAGVILFFTALSAALGPLLM
GLVGDIFGHVKYGFYLATGFAFMLCLLAAYNLLRDPSGHLLTADAK
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggttaaccatatgaaggataatgagaatagcggtaacactaggataagaatactcacg
tatttaatgttttttatgttcgcgatgacttctgatgcggtgggagtgattattcctgag
ctgattaacacatttgatttatcgatgtctcaagcgagcgcatttcattacatgccaatg
ctatttatcgcattaagtggactgtttttgggctttttggcggataagttaggccgaaaa
ataacaattctaattggcttgctgctgtttgcattggcaagttttatgttcgcattaggt
gagtcattttattattttctgtgtttgttggcattagtgggtattgctattggggtgttc
aaaacgggtgcgttagggttaattggagatatttcagctaactcaaaacaacactcaagc
accatgaacaccgtcgaaggctatttcggtgtgggcgctatggtcggtccggcgattgtc
agttatttattgataacaggagtgtcgtggaaatatctgtattttggtgccggggtgttt
tgtttaatattatgttggttagcttataaagctgactatccgcaacttaagcgctcatcc
actcaagatattaatctagccagtacgtttagaatgatgagaaacccttacgcattaggc
tactctttagcgattgggctttatgttgcgactgaagtggctatttatgtatggatgccg
acattgttactaaactatgaaggtgagttagcattaatcgcgacctatgcattaacaatc
tttttcacattgcgggcattgggacgtttcttgggcggttggatcctcaatcgatacagt
tggcagcaagtgatgttttggttcagcctagcgattagtctttgttacctaggtgcaatg
atgtatggcatatctgcagcggttattttattgccattatcaggcttgtttatgtcaatg
atgtatccgacattaaattctaaagggattagttgtttcccggttgaccaacatggttcg
gttgctggggttattttattctttactgcactttctgctgcattaggtccgttgttaatg
gggctggtaggcgacatatttggccatgttaagtacgggttttatttagcaaccggcttt
gcatttatgttgtgcttattggcagcttacaatctgcttcgtgatccgtcagggcatttg
ttgaccgcagacgctaaataa

DBGET integrated database retrieval system