KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_0065Help
Entry
SFyv_0065         CDS       T03315                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Brite
KEGG Orthology (KO) [BR:sfs00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SFyv_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AIL38884
Position
complement(50033..50284)
Genome map
AA seq 83 aa AA seqDB search
MQLLGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMI
DENGVPFSIDIPVFRLAVPTLIH
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
gtgcagttgttggggcgttactggctgatcaccaatggcaatggccgtgaaaccgaagtc
cagggcgaaggagtggttggcgtccagccacttatcgcgcctggcgaagagtaccagtac
accagcggtgcaatcattgaaaccccgctgggcaccatgcagggtcactacgaaatgatc
gatgaaaatggcgtccctttcagcatcgacattcccgtattccgactcgccgttcccaca
ctcattcattaa

DBGET integrated database retrieval system