KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_2064Help
Entry
SFyv_2064         CDS       T03315                                 

Definition
(GenBank) RRmA
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Brite
KEGG Orthology (KO) [BR:sfs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sfs03009]
    SFyv_2064
Enzymes [BR:sfs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     SFyv_2064
Ribosome biogenesis [BR:sfs03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SFyv_2064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_12 MTS Methyltransf_23 Methyltransf_4 Ubie_methyltran Methyltransf_32 DUF938 PrmA MetW Methyltransf_29 PCMT Pox_MCEL Methyltransf_8 Methyltransf_2 Methyltransf_9 Rad50_zn_hook NodS AdoMet_MTase
Motif
Other DBs
NCBI-ProteinID: AIL40442
Position
1483315..1484124
Genome map
AA seq 269 aa AA seqDB search
MSFSCPLCHQPLSREKNSYICPQRHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMMQARRA
FLDAGHYQPLRDAIVAQLRERLDEKATAVLDIGCGEGYYTHAFADALPEITTFGLDVSKV
AIKAAAKRYPQVTLCVASSHRLPFSDTSMDAIIRIYAPCKAEELARVVKPGGWVITATPG
PRHLMELKGLIYNEVHLHAPHAEQLEGFTLQQSAELCYPMRLRGDEAVALLQMTPFAWRA
KPEVWQTLAAKEVFDCQTDFNIHLWQRSY
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttttcctgtccactttgccatcagcctctttcgcgtgaaaaaaacagctatatc
tgtccccaacgacatcagtttgatatggcgaaagaagggtatgtcaatctgctgcccgtt
cagcataaacggtctcgtgatccgggcgacagcgcggaaatgatgcaagcacgccgcgca
ttcttagatgccggacattatcagccgctgcgtgatgcaattgtcgcccaactgcgggaa
cggcttgatgaaaaggccacggcggtgctggatattggctgtggtgaagggtattacaca
cacgcatttgccgatgcgttgcccgaaatcaccacgtttggcctggatgtctcgaaggta
gcgataaaagcggcggcgaaacgctatccgcaggtcactctttgtgtcgcttccagccac
cgtttgccgttttccgataccagtatggacgccataatacgtatttacgcgccgtgtaaa
gcagaagaattagcacgagtagtgaagcccggcggctgggtcattactgccacgccggga
ccgcgacatttgatggagctgaaggggctgatttacaatgaagtacatcttcatgcacct
catgcagaacaactggaaggttttacattacagcagagtgcggagttgtgttatccgatg
cgtcttcgcggtgatgaagccgtcgcattattgcagatgacgccgtttgcctggcgtgcg
aagccagaagtctggcaaacactggcagcaaaagaagtgttcgactgccagacggacttt
aatattcacctctggcagcgttcttattaa

DBGET integrated database retrieval system