KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_2140Help
Entry
SFyv_2140         CDS       T03315                                 

Definition
(GenBank) Selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Pathway
sfs00450  Selenocompound metabolism
sfs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SFyv_2140
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sfs03016]
    SFyv_2140
Enzymes [BR:sfs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     SFyv_2140
Transfer RNA biogenesis [BR:sfs03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    SFyv_2140
 Prokaryotic Type
    SFyv_2140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AIL40501
Position
1535613..1536656
Genome map
AA seq 347 aa AA seqDB search
MSENSIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNG
TSVISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINKLSPEIARE
VTEGGRYACRQAGIALAGGHSIDAPEPIFGLAVTGIVPTERVKKNSTAQAGCKLFLTKPL
GIGVLTTAEKKSLLKPEHQGLATEVMCRMNIAGASFANIEGVKAMTDVTGFGLLGHLSEM
CQGAGVQARVDYEAIPKLPGVEEYIKLGAVPGGTERNFASYGHLMGEMPREVRDLLCDPQ
TSGGLLLAVMPEAENEVKTTAAEFGIELTAIGELVPARGGRAMVEIR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaactcgattcgtttgacccaatacagccacggagctggttgcggctgtaaa
atttccccaaaagtgttggaaaccatcctgcacagtgagcaggcgaagtttgttgatccg
aatttgcttgtgggtaatgaaacccgcgacgatgcggcggtgtacgatctgggcaatggc
accagcgttatcagtaccaccgacttctttatgccgatcgttgataatcctttcgatttt
ggccgcattgcggcgactaacgccatcagcgatatcttcgcgatggggggcaaaccgatt
atggcgattgcgatcctcggctggccgattaacaaactttccccggaaattgcccgcgaa
gtaaccgaaggtggacgctatgcatgccgtcaggcgggtattgcgctggctggcggtcac
tccatcgatgcgccggagccgatttttggtctggcggtaacggggatcgtaccgaccgag
cgggtgaagaaaaacagtaccgcacaagccggatgcaaactgttcctgacgaaaccgctg
gggatcggcgttcttaccacggctgagaaaaaatcactgttgaaaccagaacatcaggga
ctggcgacggaagtgatgtgccggatgaacatcgcaggcgcgtcctttgccaacatcgaa
ggcgtaaaagcgatgaccgacgttacgggctttggtctgctgggccacttgagcgaaatg
tgtcagggggctggtgtgcaggcacgcgtcgactatgaagcgatcccgaaactccccggt
gttgaagagtacattaagttgggcgcagtacctggcggcactgaacgtaactttgccagc
tacggtcatctgatgggtgaaatgccgcgtgaagtgcgcgatctgctgtgcgatccgcaa
acttctggcggtttgctgctggcggtcatgccggaagcagaaaatgaggttaaaactaca
gccgccgagtttggcattgaactgacggcgattggcgaactggtgccagcgcgcggcggt
cgtgccatggttgagatccgttaa

DBGET integrated database retrieval system