KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_3037Help
Entry
SFyv_3037         CDS       T03315                                 

Definition
(GenBank) Histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Pathway
sfs00340  Histidine metabolism
sfs00350  Tyrosine metabolism
sfs00360  Phenylalanine metabolism
sfs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sfs00401  Novobiocin biosynthesis
sfs01100  Metabolic pathways
sfs01110  Biosynthesis of secondary metabolites
sfs01130  Biosynthesis of antibiotics
sfs01230  Biosynthesis of amino acids
Module
sfs_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sfs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SFyv_3037
   00350 Tyrosine metabolism
    SFyv_3037
   00360 Phenylalanine metabolism
    SFyv_3037
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SFyv_3037
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    SFyv_3037
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfs01007]
    SFyv_3037
Enzymes [BR:sfs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     SFyv_3037
Amino acid related enzymes [BR:sfs01007]
 Aminotransferase (transaminase)
  Class II
   SFyv_3037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Alliinase_C
Motif
Other DBs
NCBI-ProteinID: AIL41216
Position
2138062..2139132
Genome map
AA seq 356 aa AA seqDB search
MSTVTITDLARENVRNLTPYQSARRLGGNGDVWLNANEYPTAVEFKLTQQTLNRYPECQP
KAVIENYAQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSVSAETI
GVECRTVPTLENWQLDLQGISDKLDGVKVVYVCSPNNPTGQLINPQDFRTLLELTRGKAI
VVADEAYIEFCPQASLAGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKVI
PPYPLSTPVADIAAQALSPQGIVAMSERVAQIITEREYLIAALKEIPCVEQVFDSETNYI
LARFKASSAVFKSLWDQGIILRDQNKQPSLSGCLRITVGTREESQRVIDALRAEQV
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtgactattactgatttagcgcgtgaaaacgtccgcaacctgacaccgtat
cagtcggcgcgtcgtctgggcggtaacggcgacgtctggctgaacgccaacgaatatccc
acagccgtggagtttaagcttactcagcaaacgctcaaccgctacccggaatgccagcca
aaagcggtgattgaaaattacgcgcaatatgcaggcgtaaaaccggaacaggtgctggtc
agccgtggcgcggacgaaggtattgaactgctgatccgcgctttttgcgaaccgggtaaa
gacgccatcctctactgcccgccaacgtacggcatgtacagcgtcagcgctgaaaccatt
ggtgtcgaatgccgcacagtgccgacgctggaaaactggcaactggacttacagggcatt
tccgacaagctggacggcgtaaaagtggtctatgtttgcagccccaacaaccccaccggg
caactgatcaatccgcaggattttcgcaccctgctggagctaacccgcggtaaggcgatt
gtggttgccgatgaagcttatatcgagttttgcccgcaggcatcgttagctggctggctg
gcggaatatccgcacctggcgattttgcgtaccctttcgaaagccttcgcgttggcgggg
cttcgttgcggatttacgctggcaaacgaagaagtcatcaacctgctgatgaaagtgatc
cccccctacccgctctcgacgccggttgccgacattgccgcacaggcgttaagcccgcag
ggaatcgtcgccatgagcgaacgggtggcgcaaattattacagaacgcgaatacctgatt
gccgcactgaaagagatcccctgcgtggagcaggttttcgactctgaaaccaactacatt
ctggcgcgctttaaagcctccagtgcagtgtttaaatctttgtgggatcagggcattatc
ttacgtgatcagaataaacaaccctctttaagcggctgcctgcgaattaccgtcggaacc
cgtgaagaaagccagcgcgtcattgacgccttacgtgcggagcaagtttga

DBGET integrated database retrieval system