KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_3152Help
Entry
SFyv_3152         CDS       T03315                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Pathway
sfs00450  Selenocompound metabolism
sfs00970  Aminoacyl-tRNA biosynthesis
sfs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SFyv_3152
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SFyv_3152
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sfs01007]
    SFyv_3152
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sfs03016]
    SFyv_3152
Enzymes [BR:sfs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SFyv_3152
Amino acid related enzymes [BR:sfs01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SFyv_3152
Transfer RNA biogenesis [BR:sfs03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SFyv_3152
 Prokaryotic type
   Other AARSs
    SFyv_3152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AIL41309
Position
2228555..2230588
Genome map
AA seq 677 aa AA seqDB search
MTQVAKKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIM
LKAQQLGITPEQMIGEMSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFI
KNRTISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCGATYSPTELIEPKSVVSG
ATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFG
FEIPNAPGKYFYVWLDAPIGYMGSFKNLCDKRGDSVSFDEYWKKDSTAELYHFIGKDIVY
FHSLFWPAMLEGSNFRKPTNLFVHGYVTVNGAKMSKSRGTFIKASTWLNHFDADSLRYYY
TAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFINKRFDGVLASELADPELYK
TFTDAAEVIGEAWESREFGKAVREIMALADLANRYVDEQAPWVVAKQEGRDADLQAICSM
GINLFRVLMTYLKPVLPKLTERAEAFLNTELTWDGIQQPLLGHKVNPFKALYNRIDMKQV
EALVEASKEEVKATTAPVTGPLADDPIQETITFDDFAKVDLRVALIENAEFVEGSDKLLR
LTLDLGGEKRNVFSGIRSAYPDPQALIGRHTIMVANLAPRKMRFGISEGMVMAAGPGGKD
IFLLSPDAGAKPGHQVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtcgcgaagaaaattctggtgacgtgcgcactgccgtacgctaacggctca
atccacctcggccatatgctggagcacatccaggctgatgtctgggtccgttaccagcga
atgcgcggccacgaggtcaacttcatctgcgccgacgatgcccacggtacaccgatcatg
ctgaaagctcagcagctcggtatcaccccggagcagatgattggcgaaatgagtcaggag
catcagactgatttcgcaggctttaacatcagctatgacaactatcactcgacgcacagc
gaagagaaccgccagttgtcagaacttatctactctcgcctgaaagaaaacggttttatt
aaaaaccgcaccatctctcagctgtacgatccggaaaaaggcatgttcctgccggaccgt
tttgtgaaaggcacctgcccgaaatgtaaatccccggatcaatacggcgataactgcgaa
gtctgcggcgcgacctacagcccgactgaattgatcgagccgaaatcggtggtttctggt
gctacaccagtgatgcgtgattctgaacacttcttctttgatctgccctctttcagcgaa
atgctgcaggcatggacccgcagcggtgcgttgcaggagcaggtggcaaacaaaatgcag
gagtggtttgaatccggcctgcaacagtgggatatctcccgcgacgcgccatactttggt
tttgaaattccgaacgcaccgggcaaatatttctacgtctggctggacgcaccgattggc
tacatgggttctttcaagaatctgtgcgacaagcgcggcgacagcgtaagcttcgatgaa
tactggaagaaagactccaccgccgagctgtaccacttcatcggtaaagatatcgtttac
ttccacagcctgttctggcctgccatgctggaaggcagcaacttccgcaagccgaccaac
ctgtttgttcatggctatgtgacggtgaacggcgcgaagatgtccaagtctcgcggcacc
tttattaaagccagcacctggctgaatcattttgacgctgacagcctgcgttactactac
actgcgaaactctcttcgcgcattgatgatatcgatctcaacctggaagatttcgttcag
cgtgtgaatgccgatatcgtgaacaaagtggttaacctggcctcccgtaatgcgggcttt
atcaacaagcgttttgacggtgtgctggcaagcgagctggctgaccctgagctgtacaaa
acctttaccgatgccgctgaagtgattggtgaagcgtgggaaagccgtgaatttggtaaa
gcagtgcgcgaaatcatggcactggctgacctggctaaccgctatgtcgacgagcaggct
ccgtgggtagtcgcaaaacaggaaggtcgcgatgctgacctgcaggcgatttgctcaatg
ggcatcaacctgttccgcgtactgatgacttacctgaagcctgtactgccgaaactgacc
gagcgtgcagaagccttcctcaatacggaactgacctgggatggtatccagcaaccgctg
ctgggccacaaagtgaatccgttcaaggcgctgtataaccgcatcgatatgaaacaggtt
gaagctctggtggaagcctctaaagaagaagtgaaagccactaccgcgccagttactggc
ccactggcagatgatccgattcaggaaaccatcacctttgacgacttcgccaaagttgac
ctgcgcgtggcgctgatcgaaaacgcagagtttgttgaaggttctgacaaactgctgcgc
ctgacgctggatctcggcggtgaaaaacgcaatgtcttctccggtattcgttctgcttac
ccggatccgcaggcactgattggtcgtcacaccattatggtggctaacctggcaccacgt
aaaatgcgcttcggtatctctgaaggcatggtgatggctgccggtcctggcgggaaagat
attttcctgctaagcccggatgccggtgctaaaccgggtcatcaggtgaaataa

DBGET integrated database retrieval system