KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_4141Help
Entry
SFyv_4141         CDS       T03315                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Pathway
sfs00071  Fatty acid degradation
sfs00280  Valine, leucine and isoleucine degradation
sfs00310  Lysine degradation
sfs00362  Benzoate degradation
sfs00380  Tryptophan metabolism
sfs00620  Pyruvate metabolism
sfs00630  Glyoxylate and dicarboxylate metabolism
sfs00640  Propanoate metabolism
sfs00650  Butanoate metabolism
sfs00900  Terpenoid backbone biosynthesis
sfs01100  Metabolic pathways
sfs01110  Biosynthesis of secondary metabolites
sfs01120  Microbial metabolism in diverse environments
sfs01130  Biosynthesis of antibiotics
sfs01200  Carbon metabolism
sfs01212  Fatty acid metabolism
sfs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SFyv_4141
   00630 Glyoxylate and dicarboxylate metabolism
    SFyv_4141
   00640 Propanoate metabolism
    SFyv_4141
   00650 Butanoate metabolism
    SFyv_4141
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SFyv_4141
   00072 Synthesis and degradation of ketone bodies
    SFyv_4141
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SFyv_4141
   00310 Lysine degradation
    SFyv_4141
   00380 Tryptophan metabolism
    SFyv_4141
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SFyv_4141
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SFyv_4141
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SFyv_4141
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sfs04147]
    SFyv_4141
Enzymes [BR:sfs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SFyv_4141
Exosome [BR:sfs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SFyv_4141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-ProteinID: AIL42071
Position
complement(2970417..2971598)
Genome map
AA seq 393 aa AA seqDB search
MKDVVIVGALRTPIGCFRGALAGHSAVELGSLVVKALIERTGVPAYAVDEVILGQVLTAG
AGQNPARQSAIKGGLPNSVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLTDSRTGEQLGNSQLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRQLQDAYAL
SSQQKARAAIDAGRFKDEIVPVMIQSNGQTLVVDTDEQPRTDASAEGLARLNPSFDSLGS
VTAGNASSINDGAAAVMMMSEAKARALNLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERVGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRNARKGLATLCIGGGQGVALTIERDE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgttgtgattgtcggggcgttacggacacctatcggctgctttcgtggtgcg
ttagcgggtcattccgccgtggaacttggtagtctggtcgtgaaagcgttaatagaacgt
accggcgttcctgcatatgcggtggatgaagtaattcttggtcaggtgttgactgcaggg
gcagggcagaatccggcaaggcaatcggctattaaaggtggtcttcctaacagcgtttct
gcaatcacgattaatgacgtttgcggttccggtcttaaagcactgcatctggctactcag
gcgatacagtgtggcgaggctgatattgtcatcgcaggtggccaggaaaacatgagccgc
gcaccacatgttctgactgatagccgcaccggtgaacagcttggcaatagccagttggtt
gacagtctggtgcatgatgggttgtgggatgccttcaatgattatcatattggtgtcacc
gccgaaaatctggctcgcgaatatggcatcagccgtcagttgcaggatgcttacgcactt
agctcgcaacaaaaagcgcgagcggcgattgacgccggacgatttaaagatgagatcgtc
ccggtaatgatccaaagtaacggtcagacgttggttgttgataccgatgaacagccacgc
actgacgccagtgcagaaggtttagcccgtttaaatccttcatttgatagtctcggttct
gtgaccgcggggaatgcatcatccataaacgatggcgcagctgcggtaatgatgatgagc
gaagccaaagcacgagcgttgaatttacccgtgctggcccgcatccgcgcatttgccagc
gttggtgtagatccggcattgatgggaattgcgccggtgtatgcgacccgccgttgcctg
gagcgtgtaggctggcagttggctgatgtcgatcttatcgaggctaatgaagcgtttgct
gcacaggcgctttcggttggcaagatgcttgagtgggatgagcgtcgggtcaatgtcaat
ggtggcgcgatcgcactcggtcacccgataggcgcttccggttgccgaatcctggtttct
ctggttcatgaaatggtgaaacgtaatgcccgcaaagggctggcaacgctttgtatcggc
gggggccagggcgtggcattgaccattgaacgtgacgagtag

DBGET integrated database retrieval system