KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_4158
Entry
SFyv_4158         CDS       T03315                                 

Definition
(GenBank) aldehyde oxidase and xanthine dehydrogenase, molybdopterin binding domain protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Pathway
sfs00230  Purine metabolism
sfs01100  Metabolic pathways
sfs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SFyv_4158
Enzymes [BR:sfs01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     SFyv_4158
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AIL42085
Position
2984962..2986911
AA seq 649 aa
MARDELTAEKAAQLVSIEWQELPVITTPEAALTEDAAPIHNGGNLLKQSTMSTGNVQQTI
DAADYQVQGHYQTPVIQHCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPW
SCVRVIKPFVGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTID
GQMGVNRDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNL
PSAGAMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRICSAGL
PECLEKGRKIFEWEKRRAECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDG
TINVQSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVA
APALRSAALLLKEKIIAHAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYH
PERGGQLSAESSIKTTTNPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEG
QVHGGMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAY
GHKSLGEPPIIPVAAAIRNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 1950 nt   +upstreamnt  +downstreamnt
gtggcccgcgatgaactcacggcagaaaaagcggcgcaattggtcagcattgagtggcaa
gaattacccgttatcaccacgccagaagcggcgctgacagaagacgctgcaccaatccat
aacggcggcaatttactgaaacaaagcacgatgtcgacgggcaatgtccaacaaacaatc
gatgccgccgactaccaggtacaggggcactatcagactcccgttattcaacattgtcac
atggaaagcgtaacatcgctggcgtggatggaggatgactcgcgaattaccatcgtttcc
agcacccagatcccgcacattgttcgccgcgtggttggtcaggcgctggatattccctgg
tcatgcgtacgagtcatcaaaccgtttgtcggtggcggttttggtaataaacaggatgta
ctggaagagccaatggcggcattcctgaccagcaagcttggcggcattccggtgaaagtt
tcccttagccgtgaagagtgtttcctcgcaacccgtacccgccacgcttttactattgac
gggcaaatgggcgtgaaccgcgacggaaccttgaaaggttatagtctggatgttctgtct
aacaccggcgcttatgcatctcacgggcactccatcgcttctgcgggggggaataaagtc
gcttacctttatcctcgttgtgcctacgcttacagttcaaagacctgctataccaacctc
ccctcggctggtgcgatgcgtggttatggcgcgccacaagtcgtatttgccgttgagtct
atgcttgatgacgccgcgacagcgttaggtattgatcctgttgaaattcgtttacgcaac
gccgcccgcgaaggagatgctaatccgctcacgggcaaacgtatttgcagcgcagggttg
ccggagtgtcttgaaaaaggccggaaaatctttgaatgggaaaaacgccgtgcagaatgc
cagaaccagcaaggcaatttgcgccgcggcgttggcgtcgcctgttttagctacacctct
aacacctggcctgtcggcgtagaaatagcaggcgcgcgccttctgatgaatcaggatgga
accatcaacgtgcaaagcggcgcgacggaaatcggtcagggtgccgacaccgtcttctcg
caaatggtggcagaaaccgtgggggttccggtcagcgacgttcgcgttatttcaacacaa
gataccgacgttacgccgttcgatcccggcgcatttgcctcacgccagagctatgttgcc
gcgcctgcgctgcgcagtgcggcactattattaaaagagaaaatcatcgctcacgccgca
gtcatgctacatcagtcagcgatgaatttgaccctgataaaaggccatatcgtgctggtt
gaacgaccggaagagccgttaatgtcgttaaaagatttggcgatggacgctttctaccac
cctgaacgcggcgggcagctctctgctgaaagctccatcaaaaccaccactaacccaccg
gcgtttggctgtacctttgttgatctgacggtcgatattgcgctgtgcaaagtcaccatc
aaccgcatcctcaacgttcatgattcagggcatattcttaatccactgctggcagaaggt
caggtacacggcggaatgggaatgggcattggctgggcgctatttgaagagatgatcatc
gatgctaaaagcggcgtggtccgtaaccccaatctgctggattacaaaatgccgaccatg
ccggatctgccacaactggaaagcgcgttcgtcgaaatcaatgagccgcaatccgcatac
ggacataagtcactgggtgagccacccataattcctgttgccgctgctattcgtaacgcg
gtgaagatggctaccggtgttgcaatcaatacactgccgctgacgccaaaacggttatat
gaagagttccatctggcaggattgatttga

DBGET integrated database retrieval system