KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_5715Help
Entry
SFyv_5715         CDS       T03315                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 3
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Pathway
sfs00010  Glycolysis / Gluconeogenesis
sfs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFyv_5715
Enzymes [BR:sfs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     SFyv_5715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD PNK3P
Motif
Other DBs
NCBI-ProteinID: AIL43241
Position
4102446..4103045
Genome map
AA seq 199 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGAWSDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEA
LCHEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWPEE
YPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGIT
SILVKDKTTIPDYFAKVLC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctatatctttgatttaggtaatgtgattgtcgatatcgactttaaccgtgtgctg
ggagcctggagcgatttaacgcgtattccgctggcatcgcttaagaagagttttcatatg
ggggaggcgtttcatcagcatgagcgtggggaaattagcgacgaagcgttcgcagaggcg
ctgtgtcatgagatggctctaccgctaagctacgagcagttctctcacggctggcaggcg
gtgtttgttgcgctgcgcccggaagtgatcgccatcatgcataaactgcgtgagcagggg
catcgcgtggtggtgctttccaataccaaccgcctgcataccaccttctggccggaagaa
tacccggaaattcgtgatgctgctgaccatatctatctgtcgcaagatctggggatgcgc
aaacctgaagcacgaatttaccagcatgttttgcaggcggaaggtttttcacccagcgat
acggtctttttcgacgataacgccgataatatagaaggagctaatcagctaggcattacc
agtattctggtgaaagataaaaccaccatcccggactatttcgcgaaggtgttatgctaa

DBGET integrated database retrieval system