KEGG   Shigella flexneri Shi06HN006 (serotype Yv): SFyv_5915Help
Entry
SFyv_5915         CDS       T03315                                 

Definition
(GenBank) Homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
sfs  Shigella flexneri Shi06HN006 (serotype Yv)
Pathway
sfs00270  Cysteine and methionine metabolism
sfs00920  Sulfur metabolism
sfs01100  Metabolic pathways
sfs01110  Biosynthesis of secondary metabolites
sfs01130  Biosynthesis of antibiotics
sfs01230  Biosynthesis of amino acids
Module
sfs_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:sfs00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SFyv_5915
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SFyv_5915
Enzymes [BR:sfs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     SFyv_5915
    2.3.1.46  homoserine O-succinyltransferase
     SFyv_5915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: AIL43383
Position
4245915..4246508
Genome map
AA seq 197 aa AA seqDB search
MEFNDVAYWPQIKQVLEWSKDHVTSTLFVCWAVQAALNILYGIPKQTRTDKLSGVYEHHI
LHPHALLTRGFDDSFLAPHSRYADFPAALIRDYTDLEILAETEEGDAYLFASKDKRIAFV
TGHPEYDAQTLAQEYLRDVEAGLDPDVPYNYFPHNDPQNKPRASWRSHGNLLFTNWLNYY
VYQITPYDLRHMNPTLD
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggagtttaatgatgtcgcttactggccgcagatcaaacaggtgctggagtggtcgaaa
gatcacgtcacctcgacgctgtttgtctgctgggcggtacaggccgcgctcaatatcctc
tacggcattcctaagcaaactcgcaccgacaaactctctggcgtttacgagcatcatatt
ctccatcctcatgcgcttctgacgcgtggctttgatgattcattcctggcaccgcattcg
cgctatgctgactttccggcagcgttgattcgtgattacaccgatctggaaattctggca
gagacggaagaaggggatgcatatctgtttgccagcaaagataagcgcattgcctttgtg
acgggccatcccgaatatgatgcgcaaacgctggcgcaggaatatttacgcgatgtggaa
gccggactagacccggatgtaccgtataactatttcccgcacaacgatccgcaaaacaaa
ccgcgagcgagctggcgtagtcacggtaatttgctgtttaccaactggctcaactattac
gtctatcagatcacgccatacgatctacggcacatgaatccaacgctggattaa

DBGET integrated database retrieval system