KEGG   Shigella flexneri NCTC1 (serotype 2a): NCTC1_00471Help
Entry
NCTC1_00471       CDS       T03751                                 

Gene name
cysS
Definition
(GenBank) cysteinyl-tRNA synthetase,Cysteine--tRNA ligase,cysteinyl-tRNA synthetase,Cysteinyl-tRNA synthetase,cysteine--tRNA ligase,tRNA synthetases class I (C) catalytic domain
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
sft  Shigella flexneri NCTC1 (serotype 2a)
Pathway
sft00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sft00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NCTC1_00471 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sft01007]
    NCTC1_00471 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sft03016]
    NCTC1_00471 (cysS)
Enzymes [BR:sft01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     NCTC1_00471 (cysS)
Amino acid related enzymes [BR:sft01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   NCTC1_00471 (cysS)
Transfer RNA biogenesis [BR:sft03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    NCTC1_00471 (cysS)
 Prokaryotic Type
    NCTC1_00471 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 Mut7-C
Motif
Other DBs
NCBI-ProteinID: CDX05748
UniProt: A0A3T4Z5K0
Position
1:472184..473569
Genome map
AA seq 461 aa AA seqDB search
MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGYK
LKYVRNITDIDDKIIKRANENGESFVALVDRMIAEMHKDFDALNILRPDMEPRATHHIAE
IIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGVLSRQDLDQLQAGARVDVVDDKRNRMD
FVLWKMSKEGEPSWPSPWGAGRPGWHIECSAMNCKQLGNHFDIHGGGSDLMFPHHENEIA
QSTCAHDGQYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRS
QLNYSEENLKQARAALERLYTALRGTDKTVAPAGGEAFEARFIEAMDDDFNTPEAYSVLF
DMAREVNRLKAEDMAAANAMASHLRKLSAVLGLLEQEPEAFLQSGAQADDSEVAEIEALI
QQRLDARKAKDWAAADAARDRLNEMGIVLEDGPQGTTWRRK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaatcttcaatactctgacacgccaaaaagaggaatttaagcctattcacgcc
ggggaagtcggcatgtacgtgtgtggaatcaccgtttacgatctctgtcatatcggtcac
gggcgtacctttgttgcttttgacgtggttgcgcgctatctgcgtttcctcggctataaa
ctgaagtatgtgcgcaacattaccgatatcgacgacaaaatcatcaaacgcgccaatgaa
aatggcgaaagctttgtggcgctggtggatcgcatgatcgccgaaatgcacaaagatttt
gatgctttgaacattctgcgcccggatatggagccgcgcgcgacgcaccatatcgcagaa
attattgaactcactgaacaactgatcgccaaaggtcacgcttatgtggcggacaacggc
gacgtgatgttcgacgtcccgaccgatccaacttatggcgtgctgtcgcgtcaggatctc
gaccagctgcaggctggcgcgcgcgttgacgtggttgatgacaaacgcaaccggatggac
ttcgttctgtggaagatgtcgaaagagggcgaaccgagctggccgtctccgtggggcgcg
ggtcgtcctggctggcacattgaatgttcggccatgaactgcaagcagctgggtaaccac
tttgatatccacggcggcggttcagacctgatgttcccgcaccacgagaacgaaatcgcg
cagtccacctgtgcccatgatggtcagtatgtgaactactggatgcactccggaatggtg
atggttgaccgcgagaagatgtccaaatcgctgggtaacttctttaccgtgcgcgatgtg
ctgaaatactacgacgcggaaaccgtgcgttacttcctgatgtcgggccactatcgcagc
cagctgaactacagcgaagagaacctgaagcaggcgcgtgcggcgctggagcgcctctac
actgcgctgcgcggcacagataaaaccgttgcgcctgccggtggcgaagcgtttgaagcg
cgctttattgaagcgatggacgacgatttcaacaccccggaagcctattccgtgctgttt
gatatggcgcgtgaagtgaaccgtctgaaagcagaagatatggcagcggcgaatgcaatg
gcatctcacctgcgtaaactttccgctgtattgggcctgctggagcaagaaccggaagcg
ttcctgcaaagcggcgcgcaggcagacgacagcgaagtggctgagattgaagcgttaatt
caacagcgtctggatgcccgtaaagcgaaagactgggcggcggcagatgcggcacgtgac
cgtcttaacgagatggggatcgtgctggaagatggcccgcaagggaccacctggcgtcgt
aagtaa

DBGET integrated database retrieval system